KEGG   Pseudomonas putida S16: PPS_4561Help
Entry
PPS_4561          CDS       T01570                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ppt  Pseudomonas putida S16
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ppt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PPS_4561
   01230 Biosynthesis of amino acids
    PPS_4561
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPS_4561
   00051 Fructose and mannose metabolism
    PPS_4561
   00562 Inositol phosphate metabolism
    PPS_4561
Enzymes [BR:ppt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PPS_4561
Exosome [BR:ppt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PPS_4561
  Exosomal proteins of bladder cancer cells
   PPS_4561
  Exosomal proteins of melanoma cells
   PPS_4561
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5164808..5165551)
Genome map
AA seq 247 aa AA seqDB search
MVAGNWKMHGTRASVAELTEGLRNLALPSGVEVVVFPPALFINQVIDGLAGKEITVGAQN
SAVQPEQGALTGEVAPEQLVEAGCKLVLIGHSERRQIIGETDEVLNRKFAAAQAKGLKPV
LCIGETLEEREAGKTLEVVGRQLSSIIEAFGVKAFANAVIAYEPVWAIGTGLTATPQQAQ
DVHAAIRSQLAAKDAEVAAKVQLLYGGSVKAANAAELFGMPDIDGGLIGGASLNADEFGA
ICRAAGN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggtagctggtaactggaagatgcacggtacccgcgctagcgtcgctgagctgaccgaa
ggcttgagaaatctggccttgccgagcggagtggaagtcgttgtatttccaccggccttg
ttcatcaatcaagtgatcgatggcctggcaggtaaggaaattactgtcggcgcacagaat
tctgcagtacaacccgaacagggtgcgctgaccggagaagttgctccggaacagctggtt
gaagcaggctgcaagttggtgttgattggtcattcggagcgtcgccagatcattggtgaa
accgacgaagtgctcaatcgcaagtttgcagcggcccaggccaaaggtttgaagccagtg
ctttgcatcggggaaacccttgaagagcgtgaggctggcaaaacgctcgaagttgtcggg
cgtcaactaagcagtatcatcgaggcattcggtgttaaggcttttgccaatgcagtaatt
gcctatgagcctgtatgggccatcggtaccggccttacggccacgccacagcaggcccag
gatgtgcacgcagccatccgtagccagttggcggcaaaagatgctgaagtggctgcgaag
gtgcagttgctctacggcggcagcgtgaaggcggccaatgcggccgaactgttcggcatg
ccggatatcgatggggggctcattggtggagcttccctgaacgcagacgaattcggtgca
atttgtcgcgccgcaggaaactga

DBGET integrated database retrieval system