KEGG   Pseudomonas putida S16: PPS_4561Help
Entry
PPS_4561          CDS       T01570                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ppt  Pseudomonas putida S16
Pathway
ppt00010  Glycolysis / Gluconeogenesis
ppt00051  Fructose and mannose metabolism
ppt00562  Inositol phosphate metabolism
ppt01100  Metabolic pathways
ppt01110  Biosynthesis of secondary metabolites
ppt01120  Microbial metabolism in diverse environments
ppt01130  Biosynthesis of antibiotics
ppt01200  Carbon metabolism
ppt01230  Biosynthesis of amino acids
Module
ppt_M00002  Glycolysis, core module involving three-carbon compounds
ppt_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ppt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPS_4561
   00051 Fructose and mannose metabolism
    PPS_4561
   00562 Inositol phosphate metabolism
    PPS_4561
Enzymes [BR:ppt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PPS_4561
Exosome [BR:ppt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PPS_4561
  Exosomal proteins of bladder cancer cells
   PPS_4561
  Exosomal proteins of melanoma cells
   PPS_4561
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEJ15092
UniProt: F8G6H2
Position
complement(5164808..5165551)
Genome map
AA seq 247 aa AA seqDB search
MVAGNWKMHGTRASVAELTEGLRNLALPSGVEVVVFPPALFINQVIDGLAGKEITVGAQN
SAVQPEQGALTGEVAPEQLVEAGCKLVLIGHSERRQIIGETDEVLNRKFAAAQAKGLKPV
LCIGETLEEREAGKTLEVVGRQLSSIIEAFGVKAFANAVIAYEPVWAIGTGLTATPQQAQ
DVHAAIRSQLAAKDAEVAAKVQLLYGGSVKAANAAELFGMPDIDGGLIGGASLNADEFGA
ICRAAGN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggtagctggtaactggaagatgcacggtacccgcgctagcgtcgctgagctgaccgaa
ggcttgagaaatctggccttgccgagcggagtggaagtcgttgtatttccaccggccttg
ttcatcaatcaagtgatcgatggcctggcaggtaaggaaattactgtcggcgcacagaat
tctgcagtacaacccgaacagggtgcgctgaccggagaagttgctccggaacagctggtt
gaagcaggctgcaagttggtgttgattggtcattcggagcgtcgccagatcattggtgaa
accgacgaagtgctcaatcgcaagtttgcagcggcccaggccaaaggtttgaagccagtg
ctttgcatcggggaaacccttgaagagcgtgaggctggcaaaacgctcgaagttgtcggg
cgtcaactaagcagtatcatcgaggcattcggtgttaaggcttttgccaatgcagtaatt
gcctatgagcctgtatgggccatcggtaccggccttacggccacgccacagcaggcccag
gatgtgcacgcagccatccgtagccagttggcggcaaaagatgctgaagtggctgcgaag
gtgcagttgctctacggcggcagcgtgaaggcggccaatgcggccgaactgttcggcatg
ccggatatcgatggggggctcattggtggagcttccctgaacgcagacgaattcggtgca
atttgtcgcgccgcaggaaactga

DBGET integrated database retrieval system