KEGG   Pseudomonas putida S16: PPS_5138Help
Entry
PPS_5138          CDS       T01570                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
ppt  Pseudomonas putida S16
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ppt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPS_5138
   00030 Pentose phosphate pathway
    PPS_5138
   00051 Fructose and mannose metabolism
    PPS_5138
   00052 Galactose metabolism
    PPS_5138
   00500 Starch and sucrose metabolism
    PPS_5138
   00520 Amino sugar and nucleotide sugar metabolism
    PPS_5138
  Nucleotide metabolism
   00230 Purine metabolism
    PPS_5138
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PPS_5138
Enzymes [BR:ppt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     PPS_5138
    5.4.2.8  phosphomannomutase
     PPS_5138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5831777..5833192
Genome map
AA seq 471 aa AA seqDB search
MELPEMNDMAHLVPAALPDSIFRAYDIRGVVGKTLHAETAYWIGRAIGAQSLAQGEPQVS
VGRDGRLSGPMLVEQLIKGLVDAGCQVSDVGLVPTPALYYAANVLAGKSGVMLTGSHNPS
DYNGFKIVIAGDTLANEQIQALLTRLKTNDLTLAEGRVEKVEILDRYFQQIVEDVKLAKK
LKVVVDCGNGAAGVVAPQLIEALGCEVIPLFCEVDGNFPNHHPDPGKPENLEDLIAKVKE
TGADIGLAFDGDGDRVGVVTNTGSIVYPDRLLMLFAQDVLSRNPGAEIIFDVKCTRRLTP
LIEQHGGRALMWKTGHSLIKKKMKQTGSLLAGEMSGHIFIKERWYGFDDGIYSAARLLEI
LSKAGKSAENLFAAFPNDISTPEINIDVTDEGKFSIIDALQRDADWGEANLTTIDGVRVD
YAHGWGLVRASNTTPVLVLRFEADSNAELQRIKDVFRTQLLRVEPELQLPF
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggagcttccagagatgaacgacatggcccacctggtccccgccgcactgccagacagc
attttccgcgcgtatgacattcgcggcgtggtcggcaaaacccttcacgccgaaaccgcc
tactggatcggccgcgccatcggcgcgcagagcctggcccagggcgaaccgcaggtttcg
gtcggccgcgatggccgcctgtccggcccgatgctggtcgaacagctgatcaagggcttg
gtcgatgccggctgccaggtcagcgacgtcggtctggtgcccacccccgccctgtattac
gcagccaacgtgctggccggcaagtccggcgtgatgctgaccggtagccacaacccgtct
gactacaacggcttcaagatcgtcatcgctggcgataccctggccaacgaacagatccag
gccctgctgacccgattgaaaaccaacgacctgaccctcgccgaaggccgcgtggaaaag
gtcgagatccttgaccgctacttccagcagatcgtcgaggacgtgaagctggccaagaag
ctcaaggtggtcgtggactgcggcaacggtgccgccggcgtggtcgcgccgcaactgatc
gaagccctgggctgcgaagtgatcccgctgttctgcgaagtcgacggcaacttccccaac
caccacccggacccgggcaagccggaaaacctcgaagacctgatcgccaaggtcaaggaa
accggtgccgacatcggcctggccttcgacggtgacggcgaccgcgtcggcgtggtgacc
aacaccggcagcatcgtctaccccgatcgcctgctgatgctgtttgcccaggacgtactg
tcgcgcaacccgggtgccgagatcattttcgacgtgaaatgcacccgtcgcctgaccccg
ctgatcgagcagcacggcggccgcgcactgatgtggaagaccggccactcgctgatcaag
aagaaaatgaagcagaccggctcgctgctggccggcgagatgagcggtcacatcttcatc
aaggaacgctggtacggtttcgacgacggcatctacagcgccgcgcgcctgctggagatc
ctcagcaaggccgggaagagtgccgaaaacctgttcgccgcgttcccgaacgatatttcc
acgccggaaatcaatattgatgtgaccgacgagggtaaattcagcatcattgatgcactg
caacgcgacgccgactggggcgaagccaacctgaccaccatcgacggtgtgcgggtggac
tacgcccacggctggggcctggttcgcgcctccaacaccaccccggtgctggtgctgcgc
ttcgaggctgacagcaacgccgaattgcaacgtatcaaggatgttttccgtacccagttg
ctgcgggttgagcctgagctgcaactgccgttctga

DBGET integrated database retrieval system