KEGG   Pseudomonas putida S16: PPS_5180Help
Entry
PPS_5180          CDS       T01570                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ppt  Pseudomonas putida S16
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ppt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPS_5180
Enzymes [BR:ppt01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     PPS_5180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5875434..5876339
Genome map
AA seq 301 aa AA seqDB search
MNAMATFQVVTEQHGELNCWRISSDHAELLIAQQGAQILSYQRVGQPPLLWLSDQAIFRK
GKSVRAGVPVCWPWFGNLQRNPQAVQAMYHGEQAPAHGLARARDWQLLGIEEAGEGLRIE
FELPEAQGDLPGWPHDVELKLVVELGEDLRLNLTSRNMGNTPVTISQALHSYFAVSDVRQ
ARVEGVEGLSYIETLADWEQRQQKGPLGFAGETDRIYLATPQTLSIVDPHWERRITLTSS
GSRSAVIWNPWTERARELPDMADDGWQRMLCIETANVWDDLVELKPGGSSSLVVRIGCEM
I
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaatggctaccttccaggtcgtaaccgagcaacatggcgaactcaactgctgg
cgtatcagcagtgaccacgccgaactactgatcgcccagcagggcgcgcagatcctcagc
taccagcgcgttggccagccaccgctgctgtggctgagcgaccaggccatcttccgtaag
ggcaagtcggtacgcgccggtgtgccggtgtgctggccgtggttcggcaacctgcagcgc
aacccccaggccgtgcaggccatgtaccacggcgaacaggcacccgcccacggcctggcg
cgcgcgcgcgactggcaattgctgggtatcgaggaggcgggcgaaggcctgcgcatcgaa
ttcgaactgccggaagcgcagggtgacctgcctggctggcctcatgacgtcgagctgaag
ctggtagtggagctgggcgaggacctgcggctgaacctgaccagccggaacatgggaaat
acccccgtcaccatcagccaggcactgcacagctactttgccgtcagtgatgtgcgccaa
gcgcgggtcgaaggggtggaagggctgagctatatcgagaccctggctgactgggagcag
cgccagcagaaggggccactagggtttgccggggagactgaccggatctacctggcgacc
ccgcaaactcttagcatcgtcgacccgcattgggagcggcgcattaccttgaccagcagt
gggtcgcgctcggcggtgatctggaacccttggactgaacgggccagggaactgccagac
atggccgacgatgggtggcagcggatgctgtgcatcgagacggcgaatgtgtgggatgac
ttggtggaattgaagcctgggggcagcagctcgctggtggtcaggattggctgtgaaatg
atctga

DBGET integrated database retrieval system