KEGG   Pseudomonas putida KT2440: PP_0082Help
Entry
PP_0082           CDS       T00114                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ppu  Pseudomonas putida KT2440
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ppu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PP_0082 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PP_0082 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PP_0082 (trpA)
Enzymes [BR:ppu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PP_0082 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(91569..92378)
Genome map
AA seq 269 aa AA seqDB search
MSRLEQRFAELKAEGRSALVTFVTAGDPGYDASLQILKGLPAAGADVIELGMPFTDPMAD
GVAIQLATLRALEAGQTLVKTLQMVREFRVDNQTTPIVLMGYYNPIHRFGVDTFVTQAKE
AGVDGLIIVDLPPEHDAELATPAQAAGIDFIRLTTPTTDDARLPRVLERSSGFVYYVSVA
GVTGAGSATTEHVTEAIARLRRHTDLPISVGFGIRTPEQAANIARLADGVVVGSALVDKI
AQAKSADQAVTDVLSLCSALAEGVRGARR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtcttgaacaacgcttcgccgagctgaaggccgaaggccgctcggcactggtc
accttcgtcacagctggcgacccgggctacgacgcctcgttgcagatcctcaagggcctg
ccggctgctggcgccgacgtgatcgagctgggcatgccgttcaccgacccgatggccgat
ggcgtggccatccagctggccaccctgcgcgcccttgaagctggccagaccttggtcaag
accctgcagatggttcgcgaattccgtgtggataaccagaccacgccgatcgtgctgatg
ggctactacaaccctatccaccgctttggcgtggacacgttcgtgactcaagccaaggaa
gcgggcgtcgatggcctgatcatcgtcgaccttccgccagagcacgacgccgaactggct
accccggcccaggccgcaggcatcgacttcatccgcctgaccaccccgaccaccgacgac
gcgcgcctgccgcgcgtgctggagcgcagctccgggttcgtctactacgtgtcggtggct
ggtgtgaccggtgccggttcggcgaccaccgagcatgtgaccgaagccattgcccgcctg
cgccggcataccgatctgccgatcagcgttggcttcggcattcgcacgccggaacaggct
gcgaacattgcccgcttggcggatggtgtggtggtgggctcggcactggtcgacaagatc
gcccaggccaaaagcgccgatcaggcggtgaccgatgtattgagcctgtgctcggcattg
gctgaaggggtgcgtggcgcacgccgctaa

DBGET integrated database retrieval system