KEGG   Pseudomonas putida KT2440: PP_0082Help
Entry
PP_0082           CDS       T00114                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ppu  Pseudomonas putida KT2440
Pathway
ppu00260  Glycine, serine and threonine metabolism
ppu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ppu01100  Metabolic pathways
ppu01110  Biosynthesis of secondary metabolites
ppu01130  Biosynthesis of antibiotics
ppu01230  Biosynthesis of amino acids
Module
ppu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ppu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PP_0082 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PP_0082 (trpA)
Enzymes [BR:ppu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PP_0082 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB PEP_mutase ThiG KDGP_aldolase BtpA
Motif
Other DBs
NCBI-GeneID: 1043563
NCBI-ProteinID: NP_742252
UniProt: Q88RP7
Position
complement(91570..92379)
Genome map
AA seq 269 aa AA seqDB search
MSRLEQRFAELKAEGRSALVTFVTAGDPGYDASLQILKGLPAAGADVIELGMPFTDPMAD
GVAIQLATLRALEAGQTLVKTLQMVREFRVDNQTTPIVLMGYYNPIHRFGVDTFVTQAKE
AGVDGLIIVDLPPEHDAELATPAQAAGIDFIRLTTPTTDDARLPRVLERSSGFVYYVSVA
GVTGAGSATTEHVTEAIARLRRHTDLPISVGFGIRTPEQAANIARLADGVVVGSALVDKI
AQAKSADQAVTDVLSLCSALAEGVRGARR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtcttgaacaacgcttcgccgagctgaaggccgaaggccgctcggcactggtc
accttcgtcacagctggcgacccgggctacgacgcctcgttgcagatcctcaagggcctg
ccggctgctggcgccgacgtgatcgagctgggcatgccgttcaccgacccgatggccgat
ggcgtggccatccagctggccaccctgcgcgcccttgaagctggccagaccttggtcaag
accctgcagatggttcgcgaattccgtgtggataaccagaccacgccgatcgtgctgatg
ggctactacaaccctatccaccgctttggcgtggacacgttcgtgactcaagccaaggaa
gcgggcgtcgatggcctgatcatcgtcgaccttccgccagagcacgacgccgaactggct
accccggcccaggccgcaggcatcgacttcatccgcctgaccaccccgaccaccgacgac
gcgcgcctgccgcgcgtgctggagcgcagctccgggttcgtctactacgtgtcggtggct
ggtgtgaccggtgccggttcggcgaccaccgagcatgtgaccgaagccattgcccgcctg
cgccggcataccgatctgccgatcagcgttggcttcggcattcgcacgccggaacaggct
gcgaacattgcccgcttggcggatggtgtggtggtgggctcggcactggtcgacaagatc
gcccaggccaaaagcgccgatcaggcggtgaccgatgtattgagcctgtgctcggcattg
gctgaaggggtgcgtggcgcacgccgctaa

DBGET integrated database retrieval system