KEGG   Pseudomonas putida KT2440: PP_0083Help
Entry
PP_0083           CDS       T00114                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ppu  Pseudomonas putida KT2440
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ppu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PP_0083 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PP_0083 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PP_0083 (trpB)
Enzymes [BR:ppu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PP_0083 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(92375..93592)
Genome map
AA seq 405 aa AA seqDB search
MTQSQYRPGPDANGLFGSFGGRYVAETLMPLVLDLAREYEAAKADPKFLEELAYFQRDYI
GRPNPLYFAERLTEHCGGAKIFFKREELNHTGAHKVNNCIGQVLLAKRMGKKRLIAETGA
GMHGVATATVAARFGLPCVIYMGATDIERQQANVFRMKLLGAEIVPVTAGTGTLKDAMNE
ALRDWVTNVEDTFYLIGTVAGPHPYPAMVRDFQSIIGKETRAQLQEKEGRLPDSLVACVG
GGSNAMGLFHEFLEEPSVQIIGVEAGGHGVHTDKHAASLNGGVPGVLHGNRTYLLQDQDG
QITDAHSISAGLDYPGIGPEHAYLHEVKRVEYVSITDDEALDAFHATCRLEGIIPALESS
HALAEAIKRAPKLPKDHLMVVCLSGRGDKDMQTVMNHMAAQEKQA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgacccagtcccaataccgccccggccccgacgccaatggcctgttcggctcgttcggc
ggccgctacgtggccgaaaccctgatgccactggtgctggacctggcccgcgaatacgaa
gcggccaaggcagaccccaagtttcttgaagagctggcttactttcagcgcgactacatc
ggccgccccaacccgctgtacttcgccgagcgcctgaccgagcattgcggcggagcgaag
attttcttcaagcgtgaagagctcaaccataccggcgcgcacaaggtgaacaactgcatc
ggccaagtgctgctggccaagcgcatgggcaaaaagcgcctgatcgccgaaaccggcgcc
ggcatgcacggtgtcgccaccgccactgtcgccgcgcgcttcggcctgccttgcgtgatc
tacatgggtgccaccgacatcgagcgccagcaggcgaacgtgttccgcatgaagctgctg
ggcgccgagatcgtgccagttaccgccggcaccggtaccctgaaagacgccatgaacgaa
gccctgcgtgactgggttaccaacgtcgaagacaccttctacctgatcggcaccgtggct
ggcccacacccgtaccccgccatggtgcgcgacttccagtcgatcatcggcaaagagacc
cgtgcccagttgcaagagaaggaaggccgtctgccagacagcctggttgcctgcgtcggc
ggcggctccaatgccatgggcctgtttcatgagttcctcgaagagccgagcgtgcagatc
atcggcgttgaagccggtggccacggcgtacacaccgacaagcatgccgccagcctgaac
ggcggcgtaccgggcgtgttgcacggcaaccgcacctacctgctgcaggaccaagacggc
cagatcaccgatgcccactcgatttccgcaggcctggactacccgggcatcggcccggag
cacgcctatctgcatgaggtgaagcgcgtcgagtacgtcagcatcaccgatgacgaagca
ttggatgcgttccacgcaacctgccgtctggaaggcatcattccagccctggaaagctcc
cacgccttggccgaagcgatcaagcgcgcaccgaagctgcccaaggaccacctgatggtc
gtgtgcctgtcgggccgcggcgacaaagatatgcaaaccgtcatgaaccacatggccgcc
caggagaaacaggcatga

DBGET integrated database retrieval system