KEGG   Pseudomonas putida KT2440: PP_0129Help
Entry
PP_0129           CDS       T00114                                 

Definition
(RefSeq) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
ppu  Pseudomonas putida KT2440
Brite
Enzymes [BR:ppu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     PP_0129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
134104..136041
Genome map
AA seq 645 aa AA seqDB search
MTEDAERWKEKYLKSIEQQEKLERRWDARLDLLRRGLVRSTLAAEGSDKVVDECMKEMRD
VIRSDNMDAGLAGLIPRLEKAVLDSEQRRETRMNQVSDALTALVGQLQGLPLPSDISRPL
KKLAKKLEGGVAQSRELPPLLGELSGLQGRALSALGKPSEEARPGFLQRLFGSREEDAQA
GAELAPVALPAAEVVPQAAGSAEPSRHDDVDALQPLPAPAVPTAEVAEAPELELEAFGPA
LIETAEMPPAPLPRDKTPLPEAEVSASESLAEAEPLQALEETFGEDGPYALPYAVEPPYS
QVAAHIEQTLIGLLDDLSLPERHKAQAQEMRERVARGLNWYELIPVLDDLAVLMLAITDS
GQHEFETYLQQLNERLEGFQSHLHEASAGHADNSTAARELDSQLREHVDGLQSSVQGAAD
VDSLKHILENRLEGLLVTMDEHKHERDRREQELAGRLQGLSERVASMEHEALGYREHLEE
QRQKALLDPLTGLPNRAAWSERVEREMLDWQENGGHLAMAILDLDHFKRINDNYGHLAGD
KVLKIVADQLRKRLRGRDFIARFGGEEFVMLLPQTTPAVAAQVAEVLRATVEACPFHFKG
ERVVITTSIGLGAFRSGERSDQVLKRADAALYRAKELGRNRVEHG
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagacgctgagcgctggaaagaaaaataccttaaaagcatcgagcagcaagaa
aagctcgagcgccgttgggatgcccgtcttgacctgttgcgccgaggcctggtgcgcagc
accctggctgctgaaggcagtgacaaggtggtagacgagtgcatgaaggaaatgcgcgat
gtcattcgcagcgacaacatggacgccggcctcgctggcttgattccgcgccttgagaaa
gcggtactggattccgaacagcgtcgcgaaacccgcatgaaccaggtcagcgatgcgctg
accgcactggttggccaactgcaaggcctgcccctgcccagcgatatctcgcggccattg
aaaaaactggcgaagaagctcgagggcggggttgcccagtcacgcgagctgccgccgctg
ttgggcgagttgagcggcttgcaggggcgcgcgctgtcggcccttggcaagccgagtgaa
gaagcccgacccggttttctgcagcggttgtttggaagccgcgaggaagatgcacaggca
ggagcagagcttgcgccggtagcgttacctgctgccgaggttgtaccccaggcagccggc
agtgccgagccctcgcggcacgatgacgtcgatgcgctacaaccgttgccggcccctgct
gttccgactgccgaggtggccgaagcgcccgagcttgagctggaggcatttggcccggcg
ctgatcgaaacggccgaaatgccgccagccccgttgccaagggacaagacgccattgccg
gaagctgaagtttccgccagcgagtcgttggctgaggcagaacccttacaagcccttgaa
gaaacctttggtgaagacggcccctatgccctgccctacgcagtggagccgccttacagc
caggttgccgcgcacatcgagcagaccctgatcggtctgctcgatgacctcagcctgccc
gagcgacacaaggctcaggcgcaggaaatgcgcgagcgggttgctcgcggcttgaactgg
tatgaactgatcccggtgctggatgacttggcagtactcatgctggcgatcaccgacagc
gggcagcacgaattcgaaacctacctgcagcagctcaatgaacgcctggaaggtttccag
agccacctgcacgaggccagcgccggccacgcggacaatagcaccgctgcccgcgagctg
gatagccaactgcgtgagcacgtcgacggcctgcagagcagcgtgcaaggtgccgccgat
gtagacagcctcaagcacattctggaaaaccgcctggaaggcttgctggtgacgatggac
gagcacaagcacgagcgtgatcgccgcgagcaggaactggccggtcgcctgcaaggcttg
tcggagcgggtggcgagcatggagcatgaggcgcttggctatcgcgagcacctggaagaa
cagcgccagaaagccctgctggacccgctcaccggcctgcccaaccgtgcggcctggagc
gagcgagtcgaacgcgaaatgcttgactggcaggaaaacggcggccatctggcgatggcg
attcttgatctggaccatttcaaacgcatcaacgacaactatggtcatctggctggggac
aaggtcctcaagatcgtggccgaccagttgcgcaagcgtctgcggggccgtgatttcatc
gcccgttttggcggcgaggaattcgtcatgctgctgccgcagactacgcccgcagtcgct
gcgcaagtggccgaggtgttgcgtgccacagtcgaagcctgcccattccacttcaaggga
gaacgggtggtgatcaccacctccatcggcctgggtgcattccgttctggcgaacgcagc
gaccaggtgctcaaaagggccgatgcagcgctgtaccgggcaaaggagctggggcgtaat
cgcgtcgagcatggttag

DBGET integrated database retrieval system