KEGG   Pseudomonas putida KT2440: PP_0129Help
Entry
PP_0129           CDS       T00114                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
ppu  Pseudomonas putida KT2440
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
134104..136041
Genome map
AA seq 645 aa AA seqDB search
MTEDAERWKEKYLKSIEQQEKLERRWDARLDLLRRGLVRSTLAAEGSDKVVDECMKEMRD
VIRSDNMDAGLAGLIPRLEKAVLDSEQRRETRMNQVSDALTALVGQLQGLPLPSDISRPL
KKLAKKLEGGVAQSRELPPLLGELSGLQGRALSALGKPSEEARPGFLQRLFGSREEDAQA
GAELAPVALPAAEVVPQAAGSAEPSRHDDVDALQPLPAPAVPTAEVAEAPELELEAFGPA
LIETAEMPPAPLPRDKTPLPEAEVSASESLAEAEPLQALEETFGEDGPYALPYAVEPPYS
QVAAHIEQTLIGLLDDLSLPERHKAQAQEMRERVARGLNWYELIPVLDDLAVLMLAITDS
GQHEFETYLQQLNERLEGFQSHLHEASAGHADNSTAARELDSQLREHVDGLQSSVQGAAD
VDSLKHILENRLEGLLVTMDEHKHERDRREQELAGRLQGLSERVASMEHEALGYREHLEE
QRQKALLDPLTGLPNRAAWSERVEREMLDWQENGGHLAMAILDLDHFKRINDNYGHLAGD
KVLKIVADQLRKRLRGRDFIARFGGEEFVMLLPQTTPAVAAQVAEVLRATVEACPFHFKG
ERVVITTSIGLGAFRSGERSDQVLKRADAALYRAKELGRNRVEHG
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagacgctgagcgctggaaagaaaaataccttaaaagcatcgagcagcaagaa
aagctcgagcgccgttgggatgcccgtcttgacctgttgcgccgaggcctggtgcgcagc
accctggctgctgaaggcagtgacaaggtggtagacgagtgcatgaaggaaatgcgcgat
gtcattcgcagcgacaacatggacgccggcctcgctggcttgattccgcgccttgagaaa
gcggtactggattccgaacagcgtcgcgaaacccgcatgaaccaggtcagcgatgcgctg
accgcactggttggccaactgcaaggcctgcccctgcccagcgatatctcgcggccattg
aaaaaactggcgaagaagctcgagggcggggttgcccagtcacgcgagctgccgccgctg
ttgggcgagttgagcggcttgcaggggcgcgcgctgtcggcccttggcaagccgagtgaa
gaagcccgacccggttttctgcagcggttgtttggaagccgcgaggaagatgcacaggca
ggagcagagcttgcgccggtagcgttacctgctgccgaggttgtaccccaggcagccggc
agtgccgagccctcgcggcacgatgacgtcgatgcgctacaaccgttgccggcccctgct
gttccgactgccgaggtggccgaagcgcccgagcttgagctggaggcatttggcccggcg
ctgatcgaaacggccgaaatgccgccagccccgttgccaagggacaagacgccattgccg
gaagctgaagtttccgccagcgagtcgttggctgaggcagaacccttacaagcccttgaa
gaaacctttggtgaagacggcccctatgccctgccctacgcagtggagccgccttacagc
caggttgccgcgcacatcgagcagaccctgatcggtctgctcgatgacctcagcctgccc
gagcgacacaaggctcaggcgcaggaaatgcgcgagcgggttgctcgcggcttgaactgg
tatgaactgatcccggtgctggatgacttggcagtactcatgctggcgatcaccgacagc
gggcagcacgaattcgaaacctacctgcagcagctcaatgaacgcctggaaggtttccag
agccacctgcacgaggccagcgccggccacgcggacaatagcaccgctgcccgcgagctg
gatagccaactgcgtgagcacgtcgacggcctgcagagcagcgtgcaaggtgccgccgat
gtagacagcctcaagcacattctggaaaaccgcctggaaggcttgctggtgacgatggac
gagcacaagcacgagcgtgatcgccgcgagcaggaactggccggtcgcctgcaaggcttg
tcggagcgggtggcgagcatggagcatgaggcgcttggctatcgcgagcacctggaagaa
cagcgccagaaagccctgctggacccgctcaccggcctgcccaaccgtgcggcctggagc
gagcgagtcgaacgcgaaatgcttgactggcaggaaaacggcggccatctggcgatggcg
attcttgatctggaccatttcaaacgcatcaacgacaactatggtcatctggctggggac
aaggtcctcaagatcgtggccgaccagttgcgcaagcgtctgcggggccgtgatttcatc
gcccgttttggcggcgaggaattcgtcatgctgctgccgcagactacgcccgcagtcgct
gcgcaagtggccgaggtgttgcgtgccacagtcgaagcctgcccattccacttcaaggga
gaacgggtggtgatcaccacctccatcggcctgggtgcattccgttctggcgaacgcagc
gaccaggtgctcaaaagggccgatgcagcgctgtaccgggcaaaggagctggggcgtaat
cgcgtcgagcatggttag

DBGET integrated database retrieval system