KEGG   Pseudomonas putida KT2440: PP_0187Help
Entry
PP_0187           CDS       T00114                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ppu  Pseudomonas putida KT2440
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ppu00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
238919..239686
Genome map
AA seq 255 aa AA seqDB search
MSQWRLLLTRPAEDCAALAQSLAAAGVGSSCLPLLEIEPITVQAPQRLSLEGLHDFQAII
VVSKPAARLLLEHLAETSIQPPQRGWFTVGEATAGVLQGAGLKVCFPPRGDDSEALLALP
ALRQALTEPAPRVLIVRGVGGRELLAERLAEQGASVEYLELYRRCLPAYPAGTLMRRIEA
ERLNGLVVSSGQGFEHLQQMAGADWLRLAQLPLFVPSPRVAEQAKAAGAQQVVDCRGASA
TALLAAVQRSAAPAS
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
gtgagccaatggcgcctgttgctgacccggcctgccgaggactgcgcggcgctggcgcaa
agcctggcggcagcgggagtgggcagcagttgcctgcccctgctggagattgaacccatt
accgtgcaagccccacagcggctgtcgctggaaggcttgcatgacttccaggcgatcatt
gtggtcagcaagccggccgcccggctgttgcttgagcatctggccgagaccagcatccag
cctccgcagcgaggctggttcaccgtgggtgaggcaaccgctggtgtgctgcagggtgct
gggctgaaggtttgctttccgccgcgtggcgatgacagcgaagccttgctggcactgccg
gccctgcgccaggcacttaccgagccggcaccgcgtgtcttgatcgttcgcggcgtcgga
ggtcgcgaactgctggcagagcgtcttgcagagcaaggtgctagtgtcgaatatctggaa
ctgtatcgtcgctgcctgccggcctacccggcgggtacgctgatgcgccgcattgaagcg
gaacgcctcaatggcctggtggtcagcagtgggcagggttttgaacatttgcagcagatg
gccggtgccgattggctgcggttggcccagttgccgctgttcgtgcccagcccgcgggtc
gccgagcaggccaaggccgccggggcccaacaggttgtggattgccgtggcgccagtgcc
acggccttgctggcagccgtgcagcgtagcgctgcacctgcctcttaa

DBGET integrated database retrieval system