KEGG   Pseudomonas putida KT2440: PP_0214Help
Entry
PP_0214           CDS       T00114                                 

Gene name
gabT
Definition
4-aminobutyrate aminotransferase (EC:2.6.1.19)
Orthology
K14268  
5-aminovalerate/4-aminobutyrate aminotransferase [EC:2.6.1.48 2.6.1.19]
Organism
ppu  Pseudomonas putida KT2440
Pathway
Alanine, aspartate and glutamate metabolism
Lysine degradation
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppu00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    PP_0214 (gabT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PP_0214 (gabT)
   00310 Lysine degradation
    PP_0214 (gabT)
Enzymes [BR:ppu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     PP_0214 (gabT)
    2.6.1.48  5-aminovalerate transaminase
     PP_0214 (gabT)
Amino acid related enzymes [BR:ppu01007]
 Aminotransferase (transaminase)
  Class III
   PP_0214 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
264874..266151
Genome map
AA seq 425 aa AA seqDB search
MSKTNESLMQRRVAAVPRGVGQIHPIFVDTAKNSTVIDVEGRELIDFAGGIAVLNTGHLH
PKVVAAVQEQLTKVSHTCFQVLAYEPYVELCEKINKLVPGDFDKKTLLVTTGSEAVENAV
KIARAATGRAGVIAFTGGYHGRTMMTLGLTGKVVPYSAGMGLMPGGIFRALFPSELHGIS
VDDAIASVERIFKNDAEPRDIAAIILEPVQGEGGFLPAPKELMKRLRALCDQHGILLIAD
EVQTGAGRTGTFFAMEQMGVAPDLTTFAKSIAGGFPLAGVCGKAEYMDAIAPGGLGGTYA
GSPIACAAALAVIEVFEEEKLLDRSKAVGERLTAGLREIQKKYPIIGDVRGLGSMIAVEV
FEKGTHTPNAAAVGQVVAKAREKGLILLSCGTYGNVLRILVPLTAEDALLDKGLAIIEEC
FAEIA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaaccaacgaatccttgatgcaacgtcgtgtagctgccgtcccacgtggcgtc
ggccagatccacccgatcttcgtcgacaccgcgaagaactcgaccgtgatcgacgttgaa
ggccgcgaactgatcgacttcgccggcggcatcgcagtactgaacaccggccacctgcac
ccgaaagtagttgcagccgtgcaagagcagctgaccaaggtcagccacacctgcttccag
gtgctggcttacgagccctatgtagagctgtgcgaaaagatcaacaagctggtcccaggc
gacttcgacaagaagaccctgctggtcaccaccggctccgaagccgttgaaaacgccgtc
aagatcgcccgtgctgccactggccgcgctggcgtcatcgccttcaccggcggttatcac
ggccgtaccatgatgaccctgggcctgaccggcaaggtcgtgccgtactccgctggcatg
ggcctgatgccaggcggcatcttccgcgccctgttcccgagcgaactgcacggtatcagc
gttgacgacgccatcgcctcggtcgagcgcatcttcaagaacgacgccgagccgcgcgac
atcgccgcaatcatcctcgagccagtacaaggcgaaggcggcttcctgccagcgccgaaa
gagctgatgaagcgcctgcgcgccctgtgcgaccagcacggcatcctgctgatcgccgac
gaagtacaaactggcgctggccgtaccggcaccttcttcgccatggaacagatgggcgtt
gcgcctgacctgaccaccttcgccaaatccatcgctggcggcttcccgctggccggtgtg
tgcggcaaggccgaatacatggacgccatcgcgcctggcggcctgggcggtacctacgcc
ggttcgccgatcgcttgcgccgcggccctggccgtgatcgaagtgttcgaagaagaaaaa
ctgctggaccgcagcaaggctgtgggtgagcgcctgaccgccggcctgcgcgaaatccag
aagaagtacccgatcatcggcgacgtccgtggtctgggctcgatgattgccgtcgaagtc
ttcgagaagggcactcacaccccgaacgctgctgctgttggccaggttgtcgccaaggct
cgtgaaaagggtctgatcctgctgtcttgcggcacctacggcaacgtcctgcgtatcctg
gttccgctgaccgccgaagacgcgctgctggacaaaggcctggccatcatcgaagagtgc
ttcgctgaaatcgcctga

DBGET integrated database retrieval system