KEGG   Pseudomonas putida KT2440: PP_0261Help
Entry
PP_0261           CDS       T00114                                 

Gene name
cysQ
Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ppu  Pseudomonas putida KT2440
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:ppu00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
315184..315984
Genome map
AA seq 266 aa AA seqDB search
MHEVVKLALTAGEAILPFWRADVAVTNKADDSPVTAADLAAHRVIADGLLALAPQIPVLS
EEDCNIALAERQNWSRWWLVDPLDGTKEFIAGSEEFTVNIALIENGEVVFGVVSMPTNGR
CYFGGRGMGAWRADAGEAAQLIQVRNAPAQGERFTVVASRRHSSPEQEALLAGLGAAVGE
LELANIGSSLKFCLLAEGSADCYPRLAPTSQWDTAAAQGVVEGAGGEVIGLDGLPFRYPP
RESLLNPYFLALPVNAEWRQAFLNLI
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgcatgaagtggtcaagctggcgctgacggcaggcgaggcgatcctgccattctggcgc
gccgatgtcgcggtaaccaacaaggccgacgattcgccggttaccgccgccgacctagcc
gcgcaccgggtaatcgccgatggtctgctggcgctggcgccgcagattccggtgctgtcc
gaagaggactgcaatattgcgctggccgagcggcaaaactggagccgctggtggctggtc
gatccgctggatggcaccaaggaattcattgccggcagtgaagagttcacggtcaacatc
gccctgatcgagaacggcgaggtggtgtttggcgtggtgtcgatgcccaccaatgggcgc
tgctattttggtggacgcggcatgggggcctggcgtgcagatgccggtgaggcagcccag
ctgatccaagtacgcaacgcacccgcgcagggcgagcgttttaccgtggtggccagccgt
cggcattccagcccggagcaggaagcgctgttggccggccttggggctgcggtgggcgag
ctggagctggccaatatcggcagctcgttgaagttctgcctgttggccgagggcagcgcc
gattgttatccgcgcctggcgccgacttcgcagtgggatactgctgcggcgcagggtgtg
gtggagggggccggtggcgaagtgatcgggctggatggcttgccgttccggtatccgccg
cgcgagtcgctgcttaacccgtacttcctggcgttgccggtaaatgctgaatggcgccag
gccttcctgaacctcatctaa

DBGET integrated database retrieval system