KEGG   Pseudomonas putida KT2440: PP_0328Help
Entry
PP_0328           CDS       T00114                                 

Gene name
fdhA
Definition
formaldehyde dehydrogenase
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
ppu  Pseudomonas putida KT2440
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ppu01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:ppu00680]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:ppu00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
394617..395816
Genome map
AA seq 399 aa AA seqDB search
MSGNRGVVYLGAGKVEVQKIDYPKMQDPRGKKIEHGVILKVVSTNICGSDQHMVRGRTTA
QVGLVLGHEITGEIVEKGRDVERMQIGDLVSVPFNVACGRCRSCKEMHTGVCLTVNPARA
GGAYGYVDMGDWTGGQAEYVLVPYADFNLLKLPERDKAMEKIRDLTCLSDILPTGYHGAV
TAGVGPGSTVYVAGAGPVGLAAAASARLLGAACVIVGDLNPARLAHAKSQGFEVVDLSKD
TPLHEQIVDILGEPEVDCAVDAVGFEARGHGHEGAKHEAPATVLNSLMQVTRVAGNIGIP
GLYVTEDPGAVDAAAKIGALSIRFGLGWAKSHSFHTGQTPTMKYNRQLMQAIMWDRINIA
EVVGVQVINLDQAPEGYGEFDAGVPKKFVIDPHKMWGAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtctggcaatcgtggagtggtgtatctcggcgctggcaaggtcgaagtacagaagatc
gactacccgaaaatgcaggacccgcgcggcaagaaaatcgaacacggcgtcatcctgaag
gtggtctccaccaacatctgcggttctgaccagcacatggtccgtggccgcactactgcc
caggtcggcctggtcctgggccacgaaatcaccggtgaaatcgtcgagaagggccgcgac
gtcgagcgcatgcagatcggcgacctggtatcggtcccgttcaacgtcgcctgcggccgc
tgccgctcctgcaaagagatgcacaccggtgtctgcctcaccgtcaacccggcccgcgcc
ggcggtgcctacggctacgtcgacatgggcgactggaccggtggccaggccgaatacgtg
ctggtgccatacgccgacttcaacctgctgaagctgcctgagcgcgacaaggccatggaa
aagatccgtgacctgacctgcctgtccgacatcctgcccaccggctatcacggtgccgtg
actgctggcgttggtccaggcagcactgtctacgttgccggtgctggcccggtcggcctg
gccgccgctgcctcggcgcgcctgctgggcgccgcctgtgtaatcgtcggtgacctgaac
ccggcccgcctggcccacgccaagtcgcaaggcttcgaagtggtcgacctgtccaaggac
accccgctgcacgagcagatcgtcgacattctcggcgagccggaagtggactgcgctgtc
gacgccgtcggcttcgaggcccgtggccatggccacgaaggtgccaagcacgaggccccg
gccaccgtgctgaactcgctgatgcaagtgacccgcgtggccggcaacatcggtatcccg
ggcctgtacgtgaccgaagacccgggcgcggtggatgccgctgccaagatcggcgcgctg
agcatccgcttcggcctgggctgggcgaaatcgcacagcttccacaccggccagaccccg
accatgaaatacaaccgccagctgatgcaggcgatcatgtgggaccgcatcaacattgct
gaagtggtaggtgtgcaggtgatcaacctggatcaggcgccggaagggtatggcgagttt
gatgcaggtgtgccgaagaaattcgttatcgacccgcacaaaatgtggggtgcggcgtaa

DBGET integrated database retrieval system