KEGG   Pseudomonas putida KT2440: PP_0356Help
Entry
PP_0356           CDS       T00114                                 

Gene name
glcB
Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ppu  Pseudomonas putida KT2440
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ppu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PP_0356 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PP_0356 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    PP_0356 (glcB)
Enzymes [BR:ppu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PP_0356 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(433021..435198)
Genome map
AA seq 725 aa AA seqDB search
MTGYVQVGGLQVAKVLYDFVNNEAIPGTGIVAEQFWAGAEKIINDLAPKNKALLAKRDEL
QAKIDAWHQARKGQAHDAAAYKAFLQEIGYLLPQADDFQATTQNVDEEIAHMAGPQLVVP
VMNARFALNAANARWGSLYDALYGTDAISDEGGAEKGQGYNKVRGDKVIAFARAFLDEAA
PLAAGSHVDSTGYRIEGGKLVVALKGGSNTGLRDDAQLIGFHGDAAAPTAVLLKHNGLHF
EIQVDASTPVGSTDAAGVKDILMESALTTIMDCEDSVAAVDADDKVIVYRNWLGLMKGDL
AESVSKGGKTFTRTMNPDREYAAPNGGSVTLHGRSLLFVRNVGHLMTNPAILDAQGNEIP
EGIQDGLFTNLIALHNLNGNTSRKNTRSGSVYIVKPKMHGPEEVAFATEIFSQVEDLLGM
PRNTVKVGIMDEERRTTVNLKSCIKAAAERVVFINTGFLDRTGDEIHTSMEAGAVVRKGA
MKNEKWIGAYENNNVDVGLATGLQGRAQIGKGMWAMPDLMAAMLEQKIAHPLAGANTAWV
PSPTAATLHALHYHKVDVQARQRELASRTPASVDDILAIPLAADTNWSAEEIRNELDNNA
QGILGYVVRWIDQGVGCSKVPDINNVGLMEDRATLRISAQLLANWLRHGVVSQEQVLESL
KRMAVVVDQQNAGDPLYRPMAPNFDDNVAFQAAVELVVEGGKQPNGYTEPVLHRRRREFK
ARNGL
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgactggatacgttcaagtcggtggccttcaggtcgccaaggtcctgtacgacttcgtg
aacaacgaagccatccccgggaccggcatcgtcgccgagcagttctgggcgggtgcagag
aagatcatcaatgacctcgctccaaagaacaaagccctgctcgccaagcgcgacgagctg
caagccaagatcgacgcctggcaccaggcacgcaaaggccaggcccacgacgccgcagcc
tacaaagcattcctccaggaaatcggctacctgctgccacaagccgacgatttccaggcc
accacccagaacgtggacgaagaaatcgcccacatggccggcccacaactggtcgtgccg
gtgatgaacgcccgcttcgccctgaacgccgccaacgcccgttggggttcgctgtacgac
gccctgtacggcaccgatgccatcagcgatgaaggcggcgccgaaaaaggccagggttac
aacaaggtgcgcggcgacaaggtcatcgccttcgcccgtgccttcctcgacgaagccgcg
ccactggccgccggctcgcacgttgactccacgggctaccgcatcgaaggcggcaagctg
gttgttgccctgaaaggcggcagcaacactggcctgcgcgacgatgcgcaactgatcggc
ttccacggcgacgccgccgcgcccactgccgtgctgctcaagcacaacggcctgcacttc
gaaatccaggtcgatgccagcacccccgtcggcagcaccgacgccgctggcgtcaaagac
atcctgatggagtcggcactgaccaccatcatggactgcgaagactcggttgcagccgta
gacgctgacgacaaagtcatcgtctaccgcaactggctgggcttgatgaaaggcgacctg
gccgaaagcgtgagcaagggtggcaaaaccttcacccgcaccatgaacccggaccgcgag
tacgcggcgcctaacggcggcagcgtgaccctgcacggtcgttcgttgctgttcgtgcgc
aacgttggccacctgatgaccaacccggcgatcctcgatgcccaaggcaacgaaatcccc
gaaggtatccaggacgggctgttcaccaacctgatcgccctgcacaacctcaacggcaac
accagccgcaagaatacccgcagcggcagcgtgtacatcgtcaagccgaagatgcacggc
cctgaggaagtggccttcgccaccgagatcttcagccaggtcgaagacctgctgggcatg
ccgcgcaacaccgtcaaggtcggcatcatggacgaggaacgccgtaccacggtcaacctc
aagtcctgcatcaaggcagccgccgagcgcgtggtgttcatcaacaccggcttccttgac
cgcactggcgatgaaatccacacctcgatggaagccggcgccgtggtgcgcaaaggtgcc
atgaagaacgagaagtggatcggcgcctacgaaaacaacaacgtcgacgttggcctggcc
accggcctgcaaggccgtgcgcagatcggcaaaggcatgtgggccatgcctgacctgatg
gccgccatgctcgagcagaagatcgcccacccactggccggtgccaacaccgcctgggta
ccgtcgccaactgccgccaccctgcacgccctgcactaccacaaggtggacgtacaggcg
cgccagcgtgaactggcttcacgtaccccggcgtcggtggatgacattctggccattccg
ctggctgccgacaccaactggtcggccgaagagatccgcaacgagctggacaacaacgcc
cagggcattctcggctacgtggtgcgctggatcgaccagggcgtgggttgctcgaaggtg
ccggacatcaacaacgtcggcctgatggaagaccgtgccaccctgcgcatttctgcccag
ctgctggccaactggctgcgccacggcgtggtcagccaggaacaggtgctggaaagcctc
aagcgcatggccgtggtggtcgatcagcagaacgctggcgaccccctgtaccgcccgatg
gcgcccaacttcgacgacaacgtggcgttccaggcggctgtggaactggtagtggaaggt
ggcaagcaaccgaacggttataccgagccggtactgcaccgccgtcgccgcgagttcaag
gcgcgtaacgggttgtaa

DBGET integrated database retrieval system