KEGG   Pseudomonas putida KT2440: PP_0393Help
Entry
PP_0393           CDS       T00114                                 

Gene name
folK-1
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ppu  Pseudomonas putida KT2440
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ppu00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
477742..478251
Genome map
AA seq 169 aa AA seqDB search
MSLSTVYLGLGSNIDREAHLCAGLDALAGILTDMRCSPAFESQAVGIKSGPFINFVVTGQ
TALPLIELDRRLKFIEADNGRYAPDRKGLPLDIDVLMYDDLHGTFDGLVLPRAEILKNAF
VLWPLSLLAPDLVHPGVGKCMAQLWQEAQIDQVLAPVAFEWRGLQLTPA
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgagcacggtttacctgggcctgggcagcaacatcgaccgtgaggcgcatttg
tgcgccgggctcgatgcgttggctggcatcctgactgacatgcgctgttcgccggccttc
gaaagccaggcggtgggcatcaagagcgggccgttcatcaacttcgtggtgacggggcaa
accgcgttgccgttgatcgagctggaccgccggctgaagttcatcgaggccgacaatggc
cgctatgcaccggaccgcaaagggttgccgctggatatcgacgtgctgatgtatgacgat
ttgcacggtaccttcgatgggctggtattgccccgggccgagattctgaagaacgctttt
gtgctgtggccgctgtcgttgctggcgcccgacctggtgcatccgggtgtgggcaagtgc
atggcgcagctgtggcaggaagcgcagatcgatcaggtactggcccccgtggcctttgag
tggcgcgggttgcagttgacgcccgcttga

DBGET integrated database retrieval system