KEGG   Pseudomonas putida KT2440: PP_0393Help
Entry
PP_0393           CDS       T00114                                 

Gene name
folK-1
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ppu  Pseudomonas putida KT2440
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PP_0393 (folK-1)
Enzymes [BR:ppu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     PP_0393 (folK-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
477742..478251
Genome map
AA seq 169 aa AA seqDB search
MSLSTVYLGLGSNIDREAHLCAGLDALAGILTDMRCSPAFESQAVGIKSGPFINFVVTGQ
TALPLIELDRRLKFIEADNGRYAPDRKGLPLDIDVLMYDDLHGTFDGLVLPRAEILKNAF
VLWPLSLLAPDLVHPGVGKCMAQLWQEAQIDQVLAPVAFEWRGLQLTPA
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgagcacggtttacctgggcctgggcagcaacatcgaccgtgaggcgcatttg
tgcgccgggctcgatgcgttggctggcatcctgactgacatgcgctgttcgccggccttc
gaaagccaggcggtgggcatcaagagcgggccgttcatcaacttcgtggtgacggggcaa
accgcgttgccgttgatcgagctggaccgccggctgaagttcatcgaggccgacaatggc
cgctatgcaccggaccgcaaagggttgccgctggatatcgacgtgctgatgtatgacgat
ttgcacggtaccttcgatgggctggtattgccccgggccgagattctgaagaacgctttt
gtgctgtggccgctgtcgttgctggcgcccgacctggtgcatccgggtgtgggcaagtgc
atggcgcagctgtggcaggaagcgcagatcgatcaggtactggcccccgtggcctttgag
tggcgcgggttgcagttgacgcccgcttga

DBGET integrated database retrieval system