KEGG   Pseudomonas putida KT2440: PP_0662Help
Entry
PP_0662           CDS       T00114                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ppu  Pseudomonas putida KT2440
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ppu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PP_0662
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PP_0662
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PP_0662
Enzymes [BR:ppu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PP_0662
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
770315..771703
Genome map
AA seq 462 aa AA seqDB search
MQYTSTRGNETRVDFRTALLSGLADDGGLYVPTSVPVFSPQEIASWSWLPFDELAWRVMA
PFVGDTLDEPTLRSLVSDSYRGFRHRGIAPLQQLGHNEWILQLFHGPTRSSKDFAAQLQA
RFVRHFLGAECERVMLVGASNGDTAVAAIEALRHCPAAGLLALYPSAGTPADRAAVMRSA
ASDSVSCVAVDGSFDDCQSLVSALLRDWPCPGLIPVSFNSTNWVGVLAQIVFYFHAALQL
GGGIRPVGFSIPTASFAEIYAGFIAQKMGLPINQIIVSTNRNDALHRFIHCNRYSRGSTS
QTLSPVMDFSLFSNLERFVWELYDRDGGATRALMEHFEACGELSIGNRQWLHARMLFDSY
AVDDALIREEIVTLFHETGSAVDPHAATGVFAGRLHRRNIGAPIVTLGQFAPEKSAGLLA
ELGAWHGEVPAGAVGTAGDGPLLAPDDLAGVHALLTRLQAGR
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgcagtacacatccacgcgcggcaacgagacacgggtcgatttccgcacggcattgctt
tctggcctggccgacgatggcgggctttatgtgcccacctcggtgccggtgttcagccca
caggaaattgccagctggtcgtggttgcccttcgacgaactggcctggcgggtaatggca
ccgtttgtcggcgataccctcgacgagcctacgctcaggtcgctggtcagcgacagctat
cgcgggttccgccaccgcggcattgcgccgttgcagcagcttggccataacgaatggatc
ctgcagcttttccatgggcctacccggtcctccaaggactttgccgcgcagttgcaggcg
cgctttgtccggcactttctgggggcagagtgcgagcgggtcatgctggtcggtgccagc
aacggcgataccgcagtagcggctatcgaagcgttgcggcattgccctgcagcaggcttg
ctggcgctataccccagcgcaggcacgcccgccgaccgcgcggcagtgatgcgcagtgcc
gcgtccgacagcgtgagctgcgtggccgtggatggcagctttgacgattgccagtcgctg
gtgtcggcgctgctgcgtgactggccatgccccgggctgattccggtcagcttcaactcc
accaactgggtcggtgtgctggcgcagattgtgttctatttccatgcggcgctgcagctc
ggtggcggcatacgcccggttgggttcagcatccccacggccagttttgccgagatctac
gcggggttcattgcccagaaaatgggcctgccgatcaaccagatcatcgtctccaccaac
cgcaacgatgccttgcaccggttcatccactgcaaccgctacagccgtggctcaaccagc
cagaccttgtcaccggtcatggacttttcgctgttctccaacctggagcgcttcgtctgg
gaactgtatgaccgcgatggtggggcgacccgggcactgatggagcacttcgaggcgtgc
ggcgagctgagcatcggcaaccgccagtggttgcatgcgcgcatgctgttcgactcctat
gccgtggacgacgcgctgattcgcgaagaaattgtcacgctgttccacgaaacgggcagc
gcagtagacccccatgccgcgacaggggtattcgccgggcgcctgcaccggcgcaacatc
ggtgcgcccatcgtcacgctggggcagtttgcccccgaaaagtctgccgggctgctggcg
gagctgggggcctggcacggtgaggtgcccgccggcgcggtcggcacagcgggcgatggg
ccgctgttggcacctgacgacctggccggtgttcatgccttgttgacccggttgcaggct
gggcgatga

DBGET integrated database retrieval system