KEGG   Pseudomonas putida KT2440: PP_0675Help
Entry
PP_0675           CDS       T00114                                 

Gene name
gdhA
Definition
glutamate dehydrogenase (EC:1.4.1.4)
Orthology
K00262  
glutamate dehydrogenase (NADP+) [EC:1.4.1.4]
Organism
ppu  Pseudomonas putida KT2440
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Nitrogen metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:ppu00910]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ppu00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ppu00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
788761..790110
Genome map
AA seq 449 aa AA seqDB search
MSTMIESVDNFLARLKQRDPGQPEFHQAVEEVLRTLWPFLEANPHYLQSGILERMVEPER
AVLFRVSWVDDQGKVQVNRGYRIQMSSAIGPYKGGLRFHPSVNLSVLKFLAFEQVFKNSL
TSLPMGGGKGGSDFDPKGKSDAEVMRFCQAFMSELYRHIGADCDVPAGDIGVGAREIGFM
FGQYKRLANQFTSVLTGKGMTYGGSLIRPEATGYGCVYFAEEMLKRQDKRIDGRRVAVSG
SGNVAQYAARKVMDLGGKVISLSDSEGTLYAEAGLTDAQWDALMELKNVKRGRISELAGQ
FGLEFRKGQTPWSLPCDIALPCATQNELGAEDARTLLRNGCICVAEGANMPTTLEAVDIF
LDAGILYAPGKASNAGGVAVSGLEMSQNAMRLLWTAGEVDSKLHNIMQSIHHACVHYGEE
ADGRINYVKGANIAGFVKVADAMLAQGVV
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgtctaccatgatcgaatctgtcgacaatttccttgcacgcctgaagcagcgtgaccca
ggccagccggaattccaccaggcggtggaagaggtgctgcgcaccctgtggccattcctt
gaagccaacccccactatctgcagtccggcatcctcgagcgcatggtcgagcccgagcgc
gccgtacttttccgcgtttcttgggtcgatgaccagggcaaggtgcaggtcaaccgcggc
taccgcattcagatgagcagtgccattggcccgtacaagggcgggctgcgcttccacccg
tcggtgaacctcagcgtgctgaagttcctggcgttcgagcaggtgttcaagaactcgctg
acctcgctgcccatgggcggcggcaagggcggctcggactttgacccgaaaggcaagagc
gacgccgaagtgatgcgcttctgccaggcgttcatgagcgagctgtatcgccacatcggt
gctgactgcgacgtaccggccggtgacatcggtgtgggggcccgcgaaatcggcttcatg
ttcggccagtacaagcgcctggccaaccagttcacctcggtgttgaccggtaagggcatg
acctatggcggcagcctgatccgcccggaagccaccggctatggctgcgtttacttcgcc
gaagaaatgctcaagcgtcaggacaagcgtatcgacggccgccgcgtggcggtgtccggt
tcgggcaacgtcgcccagtatgctgcgcgtaaggtgatggacctgggcggcaaggtgatc
tcgctgtctgactctgaaggtaccttgtatgcagaagccgggctgaccgacgcccagtgg
gacgccttgatggagctgaaaaacgtcaagcgcggacgtatcagcgagctggccgggcaa
ttcggcctggagttccgcaagggccagaccccgtggagcctgccgtgcgacatcgccctg
ccatgcgccacccagaacgagctgggcgccgaagatgcccgcaccttgctgcgtaacggc
tgtatctgtgtggccgaaggcgccaacatgccgactaccctcgaggctgtggatatcttc
ctggacgccggcattctgtacgccccgggcaaggcctccaatgcgggcggcgtagccgtg
tcgggcctggaaatgtcgcagaacgccatgcgcctgctgtggacggccggtgaagtggac
agcaagctgcacaacatcatgcagtcgattcaccatgcatgcgtgcactacggtgaagag
gctgatggccggatcaactacgtcaagggggcgaacatcgcgggcttcgtgaaagtggcc
gatgcgatgctggctcagggcgtggtctga

DBGET integrated database retrieval system