KEGG   Pseudomonas putida KT2440: PP_0691Help
Entry
PP_0691           CDS       T00114                                 

Gene name
proB
Definition
(RefSeq) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
ppu  Pseudomonas putida KT2440
Pathway
ppu00330  Arginine and proline metabolism
ppu00332  Carbapenem biosynthesis
ppu01100  Metabolic pathways
ppu01130  Biosynthesis of antibiotics
ppu01230  Biosynthesis of amino acids
Module
ppu_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ppu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PP_0691 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    PP_0691 (proB)
Enzymes [BR:ppu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     PP_0691 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-GeneID: 1044519
NCBI-ProteinID: NP_742852
UniProt: Q88Q07
Position
802828..803946
Genome map
AA seq 372 aa AA seqDB search
MRSKVTGAKRWVVKIGSALLTADGKGLDRGAMAVWVEQMVALREAGVELVLVSSGAVAAG
MSQLGWTKRPSAMNELQAAASLGQMRLVQAWESSFGEHGKHTAQILLTHDDLSDRKRYLN
ARSTLRTLVDLGVVPVINENDTVVTDEIRFGDNDTLAALVANLVEADLLVILTDRDGMFD
ADPRNNPEAQLIYEARADDPSLDAVAGGTGGALGRGGMQTKLRAARLAARSGAHTIIIGG
RIERVLDRLKAGERLGTLLSPERGMLAARKQWLAGHLQTRGTLVLDAGAVQALRQANKSL
LPVGVKTVQGSFRRGEMVVCVGPDGVEVARGLANYSALEAQKIIGQSSEAIESILGYSAE
PELVHRDNLVLV
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcgaagcaaggtgacgggcgccaagcgctgggtcgttaagattggcagtgctctgctg
accgccgatggcaagggcctcgaccgcggtgcaatggccgtttgggtcgagcagatggtc
gcgctgcgtgaggcgggcgtggagttggtactggtctcctccggggccgtggctgccggc
atgagccagctgggctggaccaagcgaccgagtgcgatgaacgagctgcaggcggctgcc
tcgctcggccagatgcgtctggtgcaggcctgggagtcgagcttcggggagcacgggaag
cacaccgcgcagatcctgctgacccatgacgacctgtccgaccgcaagcgttacctgaat
gcccgcagcaccctgcgcaccttggtcgatctgggcgtggtgccggtgatcaacgaaaac
gacaccgtggtcaccgacgagatccgcttcggcgacaacgacaccctggcggcgctggtg
gccaacctggtcgaggccgacctgctggtgatcctcaccgaccgcgatggtatgttcgat
gccgacccgcgcaacaaccccgaagcgcagttgatctacgaagcccgcgccgacgacccc
tcactggatgccgtggccggtggtaccggtggtgccctgggccgtggcggcatgcagacc
aagctgcgtgcggcgcgcctggctgcccgttccggcgcccacaccatcattatcggtggc
cgcatcgagcgcgtgctggaccgcctgaaggcgggcgagcgcctgggcaccttgctgtcc
cctgagcgcggcatgctcgcggcgcgcaagcagtggctggccggtcacctgcaaacccgt
ggcaccctggtgctggatgccggtgccgtgcaagcgctgcgtcaggccaacaagagcttg
ctgccggttggcgtgaagactgtgcagggcagcttccgtcgcggcgagatggtggtgtgc
gtcggcccggacggtgttgaagtggctcgcggcctggccaactacagcgccctggaggcg
cagaagatcattggtcagtcgtccgaagccatcgagtcgatccttggctatagcgccgag
ccggaacttgtacaccgcgacaacctggtgctggtatga

DBGET integrated database retrieval system