KEGG   Pseudomonas putida KT2440: PP_0777Help
Entry
PP_0777           CDS       T00114                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ppu  Pseudomonas putida KT2440
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ppu00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:ppu00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
894676..895158
Genome map
AA seq 160 aa AA seqDB search
MSAFHDLKLEALNGGELPLAPFKGQVVLVVNVASKCGLTPQYKALENLYQIYKDKGFNVL
GLPCNQFAGQEPGSEKEIQDFCSLNYGVSFPLGSKLEVNGPQRHSLYRLLAGEGAEFPGD
ITWNFEKFLVGKDGRVLARFSPRTAPDDPAVVQAIEKALA
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcatttcacgacctgaaactggaagcgctgaacggcggagagctgcccctcgca
cccttcaagggccaagtggtgctggtggtcaacgttgcctccaaatgtggcctgacgccg
caatacaaggccctggaaaacctctaccagatctacaaagacaagggcttcaatgtgctt
ggcctgccgtgcaaccagtttgccgggcaggaaccgggtagcgaaaaggaaatccaggac
ttctgcagcctcaactacggggtcagtttcccgctggggagcaagctggaggtcaacggg
ccgcagcgccattcgttgtaccgcctgctggcaggggagggggccgagttccccggtgac
attacctggaatttcgagaagtttctggtgggcaaggatggccgggtgctggcgcgtttc
tcgccgcgcacggcgccggatgacccagcggtggtgcaggccatcgagaaagccctggcc
tga

DBGET integrated database retrieval system