KEGG   Pseudomonas putida KT2440: PP_0966Help
Entry
PP_0966           CDS       T00114                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
ppu  Pseudomonas putida KT2440
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ppu01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:ppu00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1105519..1106844
Genome map
AA seq 441 aa AA seqDB search
MTVSTAIARLNAADPDFARHLDHLLSWESVSDDAVNQRVLDIIKAVRERGDAALVEFTQR
FDGVDAKSIDDLILDRARLELALTRITPVQREALEKAANRVRIYHERQKQDSWQYTEADG
TVLGQKVTPLDRAGLYVPGGKASYPSSVLMNAIPAKVAGVTEVVMVVPTPRGEVNELVLA
AACIAGVDRVFTVGGAQAVAALAYGTESVPQVDKIVGPGNIYVATAKRHVFGQVGIDMIA
GPSEILVVCDGQTDPDWIAMDLFSQAEHDEDAQAILVSPDAAFLDRVAASIDKLMPTMER
ADIIEKSINGRGALIQVRDMQQAMDVANRIAPEHLELSVADPQAWLPHIRHAGAIFMGRH
TSEALGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSIIFCSEQGASELGHTASVLARG
ESLTAHARSAEYRILTQEKGN
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgtccactgcaattgcccgtctcaacgccgctgatccggatttcgcccgacat
ctggatcatctgctgagctgggaaagtgtgtccgatgacgcggtcaatcagcgcgtgctc
gacatcatcaaggccgtgcgtgaacgcggtgatgcggcgctggtggaattcacccagcgt
ttcgatggtgttgacgccaagtcgattgacgacctgatcctcgatcgcgcgcgcctggaa
ctggcgctgacccgtattaccccggtccagcgcgaggccctggaaaaggccgccaaccgt
gtgcgcatttatcacgagcggcagaagcaggattcctggcagtacaccgaggccgacggc
accgtgctcggccagaaggtcaccccgctggaccgtgctggcctgtatgtgccgggcggc
aaggcgtcgtacccgtcgtcggtgctgatgaacgccatcccggccaaggttgccggcgtg
actgaagtggtgatggtggtgccgaccccgcggggtgaggtcaacgagctggtactggcg
gctgcctgcatcgctggtgtcgaccgggtgttcaccgtcggtggcgcccaggccgtggct
gcgctggcctacgggactgaaagcgtgccgcaggtggacaagatcgtcggcccgggcaac
atctacgttgccaccgccaagcgccacgtgttcggccaggtaggcattgacatgatcgcc
ggcccctcggaaattctcgtggtgtgcgacggccagaccgacccggactggatcgccatg
gacctgttctcccaggccgagcacgacgaagacgcccaggccatcctggtcagcccggat
gctgctttcctcgatcgcgtggctgccagcatcgacaagctgatgccgaccatggaacgt
gccgatatcatcgagaagtcgatcaatggccgtggtgcgctgatccaggtgcgtgacatg
cagcaggccatggacgtggccaaccgcatcgcaccggagcacctggagctgtcggtggcc
gaccctcaagcctggctgccacacattcgtcacgctggcgcgatcttcatgggccgccac
accagcgaagcgctgggcgattactgcgctggccctaaccacgtgctgcccacttcaggt
accgcgcgtttttcgtcgccgctgggggtgtatgacttccagaagcgttcgtcgatcatc
ttctgctccgaacagggcgcgtccgaactgggccacactgcctcggtcctggcccgtggc
gagtcgctgaccgcccacgcccgcagcgctgaataccgtattttgacccaagagaagggg
aactga

DBGET integrated database retrieval system