KEGG   Pseudomonas putida KT2440: PP_0979Help
Entry
PP_0979           CDS       T00114                                 

Gene name
holC
Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
ppu  Pseudomonas putida KT2440
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:ppu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PP_0979 (holC)
   00240 Pyrimidine metabolism
    PP_0979 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PP_0979 (holC)
   03430 Mismatch repair
    PP_0979 (holC)
   03440 Homologous recombination
    PP_0979 (holC)
Enzymes [BR:ppu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     PP_0979 (holC)
DNA replication proteins [BR:ppu03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     PP_0979 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1118284..1118712)
Genome map
AA seq 142 aa AA seqDB search
MSKVDFYILPTDSLSARLDFACKLCEKAWRLGHRVYLHCQDAEQRSELDQRLWRFKGEAF
VPHDLAEVHADADVVLGLADNAGEHHGLLINLGASVPGFVGQFERVAEIVVEEPAIRQSA
RERFRFYREQGYALQDHRLQRL
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagtcgacttctacattctgcccaccgactcgctgtcggcgcggctcgatttc
gcctgcaaactgtgcgagaaagcttggcgcctcggccaccgggtctatctgcactgccag
gatgccgaacagcgcagtgaactggaccagcgcttgtggcgcttcaagggcgaggccttc
gtgccccacgacctcgccgaggtgcatgccgatgctgacgtggttctgggcctggctgac
aacgccggcgagcaccacggtctgctgatcaacctcggcgccagcgtgccgggctttgtc
gggcagttcgagcgggtggccgaaatcgttgttgaagagccggctatccgccaatcagcc
cgtgagcgattccgtttctaccgcgaacagggctatgctctgcaagaccaccgcttacag
cgactttga

DBGET integrated database retrieval system