KEGG   Pseudomonas putida KT2440: PP_1011Help
Entry
PP_1011           CDS       T00114                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ppu  Pseudomonas putida KT2440
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ppu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PP_1011 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PP_1011 (glk)
   00052 Galactose metabolism
    PP_1011 (glk)
   00500 Starch and sucrose metabolism
    PP_1011 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    PP_1011 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PP_1011 (glk)
   00524 Butirosin and neomycin biosynthesis
    PP_1011 (glk)
Enzymes [BR:ppu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PP_1011 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1153097..1154056
Genome map
AA seq 319 aa AA seqDB search
MKHLLVGDIGGTNARFALWRDNQLHEVNVFATVDYTNPEQAIEAYLESQGIARGGLAAVC
LAVAGPVDGDEFRFTNNHWRLSRTAFCKTLQVERLLLINDFTAMALGMTRLREGEFREVC
PGQADPSRPALVIGPGTGLGVGSLLRLGEQLWKALPGEGGHVDLPVGNAREAAIHQQIHS
QIGHVSAEAVLSGGGLVRLYQAICALDGDTPRHKTPAHITDAALGGEPRALAVVEQFCRF
LGRVAGNNVLTLGARGGVYIVGGVIPRFAELFLRSGFAASFADKGCMSGYFTGVPVWLVT
AEFSGLEGAGVALQQALDH
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacctgctggttggtgatattggcggcaccaatgcccgttttgcgttgtggcgt
gacaaccagctgcatgaagtaaatgttttcgccaccgtggactacaccaacccggagcag
gccatcgaggcctacctggaaagccaaggtatcgcccgcggtggcctggcggcggtgtgc
ctggcggtggccggcccggtcgatggcgatgaatttcgcttcaccaacaaccactggcgc
ctgagtcgcacggcattttgcaagaccttgcaggtcgagcggctgttgctgatcaatgat
ttcaccgcaatggcactgggcatgacgcgtctgcgcgaaggcgagttccgcgaggtgtgc
cccggccaggccgacccctcgaggccggcactggtgatcgggccaggtactggcctgggt
gtgggctcgctgctgcgcctgggcgaacagctctggaaggccctgccgggtgaaggcggg
catgttgacctgccggtaggcaatgctcgcgaagcggcaatccaccagcagatccacagt
cagatcggtcatgtcagcgccgaggccgtgctcagtgggggtggcctggtgcggctgtac
caggcgatctgtgcgctggacggcgacacgcccaggcacaagaccccggcgcatatcacc
gatgccgcgctgggcggggagccacgggcgctggcggtggtcgagcagttctgtcgtttc
cttgggcgagtggcgggtaataatgtgctgacgctgggcgcgcgaggcggggtctatatt
gtgggcggtgtgattccgcgctttgccgagctgttcctgcgtagcgggtttgccgcgagt
tttgccgacaaggggtgtatgagtggctatttcaccggggtgccggtgtggctggtgacg
gcggagttttccgggttggagggagcaggggtagcgttgcagcaggcgttggatcactga

DBGET integrated database retrieval system