KEGG   Pseudomonas putida KT2440: PP_1469Help
Entry
PP_1469           CDS       T00114                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
ppu  Pseudomonas putida KT2440
Brite
Enzymes [BR:ppu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PP_1469 (dsbC)
Secretion system [BR:ppu02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PP_1469 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1673964..1674746
Genome map
AA seq 260 aa AA seqDB search
MAPSGPCPPSGVPMRVTQFFAAAALALASTFAVAAATDSNAGAEQAIRKSLQNLELEVPV
ESVASSPLNGLYEVKLQGGRVLYASADGQFVMQGYLFQIQDGKPVNLTEKTERQGIAKLI
NGIPAGEMVVYPAKGETKSHITVFTDTTCPYCHKLHAEVPELNRRGIEVRYVAFPRQGLG
SSGDQQLQAVWCSSDRRGAMDKMVEGEEIKAAKCSNPVSKQFQLGQSIGVNGTPAIVLES
GQVIPGYQPAPQVAKLALAK
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtggcgccctccggcccctgtccgccttcaggagttcccatgcgcgtgacccagtttttc
gccgccgccgcgttggcgctggccagtacctttgccgttgccgcggcaaccgatagcaac
gccggtgccgagcaggccatccgtaaatcgttgcagaacctcgaactggaagtgcctgtg
gaaagcgtggccagcagcccgctcaacggcctctatgaagtcaagctgcagggcggccgc
gtgctgtacgccagcgctgacggacagttcgtgatgcagggctatctgttccagatccag
gacggcaagccggtcaacctcaccgaaaaaaccgaacgccaaggtatcgccaagctcatc
aacggcattccagccggcgagatggtggtttatcctgccaaaggcgagaccaagtcgcac
atcaccgtgttcaccgacactacctgcccgtactgccacaagctgcacgccgaagtgccc
gagttgaaccgtcgcggtatcgaagtgcgctatgtcgccttcccgcgccagggcctcggt
tcgtcgggtgaccagcagttgcaggcggtgtggtgctccagcgaccgccgcggggcgatg
gacaaaatggtcgaaggtgaagaaatcaaggccgccaagtgcagcaacccggtcagcaag
cagttccagctggggcagtcgatcggggtcaacggcacgccggccattgttcttgaaagc
ggccaggtcattccgggctaccagccggcaccacaggtcgccaagctggcacttgccaag
taa

DBGET integrated database retrieval system