KEGG   Pseudomonas putida KT2440: PP_1471Help
Entry
PP_1471           CDS       T00114                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ppu  Pseudomonas putida KT2440
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ppu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PP_1471 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PP_1471 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PP_1471 (thrC)
Enzymes [BR:ppu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PP_1471 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1676194..1677603
Genome map
AA seq 469 aa AA seqDB search
MRYISTRGQAPALNFEDVLLAGLASDGGLYVPENLPRFTQEEIASWAGLPYHELAFRVMR
PFVEGSIADADFKKILEETYGEFAHAAVAPLRQLNSNEWVLELFHGPTLAFKDFALQLLG
RLLDHVLAKRNERVVIIGATSGDTGSAAIEGCRRCDNVDIFILHPHQRVSEVQRRQMTTI
FGDNIHNIAIEGNFDDCQEMVKASFADQSFLKGTRLVAVNSINWARIMAQIVYYFHAALQ
LGGPARSVAFSVPTGNFGDIFAGYLARNMGLPVSQLIVATNRNDILHRFMSGNQYVKETL
HATLSPSMDIMVSSNFERLLFDLHGRNGGAIAELMANFKQGGGFSVEQDRWTEARKLFDS
LAVSDEQTCETIAEVFAATGEVLDPHTAIGVKAARECRRSLDTPMVVLGTAHPVKFPEAV
EKAGVGKALELPAHLSDLFSREERCTVLANDLKAVQGFVSQHGNRGKPL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatatcagtacccgcggccaggcaccggccctgaatttcgaagacgtgctgctg
gctggcctggccagcgacggcggcctgtacgtgccggaaaacctgccacgcttcacccag
gaagaaatcgcctcgtgggccggcttgccctaccacgagctggccttccgcgtgatgcgc
ccgttcgtcgaaggcagcatcgccgacgccgacttcaagaagatcctcgaagaaacctac
ggcgagttcgcccacgctgcggtcgccccgttgcgtcagctgaacagcaacgagtgggtg
ctggagctgttccacggcccgaccctggcgttcaaggactttgccctgcagttgctcggt
cgcctgcttgaccatgtgctggccaagcgcaacgagcgcgtggtcatcatcggtgccacc
agcggtgataccggttctgccgcgatcgaaggctgccgccgttgcgacaacgtcgacatc
ttcatcctgcacccgcaccagcgtgtgtcggaagtgcagcgccgccagatgactacaatc
tttggcgacaacatccacaacatcgccatcgaaggcaacttcgacgactgccaggaaatg
gtcaaggccagtttcgccgaccagtcgttcctcaagggcacccgcctggtcgccgtcaac
tcgatcaactgggcgcggatcatggcccagatcgtctactacttccatgcagccctgcag
ctgggtggcccggcgcgctcggtggcgttctcggtaccaaccggcaacttcggcgacatc
ttcgccggctacctggcgcgcaacatgggcctgccggtcagccaattgatcgtcgccacc
aaccgcaacgacatcctgcaccgcttcatgagcggcaaccagtacgtcaaggaaaccctg
cacgcgaccctgtcgccgtcgatggacatcatggtctcgtccaacttcgagcgcctgttg
ttcgacctgcatggccgcaacggtggtgcgattgccgagctgatggccaacttcaagcaa
ggtggcggcttcagcgtcgagcaagaccgctggaccgaagcccgcaaactgttcgactcg
ctggccgtcagcgacgagcaaacctgcgagaccatcgcagaagtgttcgccgccaccggt
gaagtgctcgacccgcataccgcaatcggcgtcaaggctgcccgcgagtgccgccgcagt
ctggacacgccaatggtggtgctgggtaccgcgcacccggtcaagttcccggaagcggtg
gagaaggccggtgtgggcaaggcgctggagctacccgcgcacctcagcgacctgttcagc
cgtgaagagcgttgcacggtcctggccaacgacctgaaggctgtacagggctttgtcagc
cagcacggcaaccgcggcaagccgctgtaa

DBGET integrated database retrieval system