KEGG   Pseudomonas putida KT2440: PP_1493Help
Entry
PP_1493           CDS       T00114                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
ppu  Pseudomonas putida KT2440
Pathway
Two-component system
Module
WspE-WspRF (chemosensory) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:ppu02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1698249..1699262
Genome map
AA seq 337 aa AA seqDB search
MKIAIVNDMPLAVEALRRAVALEPAHQVVWVASNGAEAVQRCTEQLPDLILMDLIMPVMD
GVEATRRIMAETPCAIVIVTVDRKQNVHRVFEAMGHGALDVVDTPALGAGDAREAAAPLL
RKILNIGWLVGQQRAPAARSVAAPLREASQRRGLVAIGSSAGGPAALEVLLKGLPAAFPA
AIVLVQHVDQVFAAGMAEWLSSAAGLPVRLAREGEPPQPGQVLLAGTNHHIRLLQNGQLA
YTAEPVNEIYRPSIDVFFESVARYWNGDAVGVLLTGMGRDGAQGLKLMRQQGFLTIAQDQ
ASSAVYGMPKAAAAIDAAVEIRPLERIAGRLTEFFAK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcgccatcgtcaatgacatgcccctggccgtcgaagcgttgcgccgggcggtc
gccctggagcccgcacaccaggtcgtgtgggtggccagcaacggtgccgaggcggtgcag
cgttgcaccgagcagttaccggacctgatcctcatggacctgatcatgccggtgatggac
ggtgtcgaggcaacccggcggatcatggccgaaaccccgtgcgccattgtcatcgtcacg
gtcgaccgtaaacagaacgtccaccgggtattcgaggccatgggccatggcgccctcgat
gtggtcgacacccctgcgttgggcgctggcgatgcccgcgaagcggcggcgcccttgctg
cgcaagatcctcaatatcggctggctggtcggccagcagcgtgcacctgccgcaaggtcg
gtggctgcaccgctgcgcgaggcttcccagcgccgcgggttggtggcaatcgggtcttcg
gcgggtggcccggcagcactcgaagtgctgctcaagggtttgccggcagcgtttccggcg
gccatcgtgctggtccagcatgtggaccaggtgtttgccgcaggcatggccgaatggctc
agcagcgcagcaggcctgccggtgcgcctggcccgtgaaggcgaaccgccgcagccaggg
caggtactcctggccggtaccaaccaccacattcgcctgctacagaatggccaactggcc
tacactgccgaacctgtgaatgaaatctaccggccctcgatcgatgtgttcttcgagagc
gtggcacgttactggaatggtgatgcagtgggcgtgctgctcaccggcatgggccgcgac
ggtgcccagggcctgaagctgatgcgtcagcagggctttctgaccattgcccaggaccag
gccagcagcgcggtgtacggcatgcccaaggctgctgcggctattgatgccgccgtggaa
atccgcccgctggaacgcattgccgggcgcttgactgaatttttcgcaaaatga

DBGET integrated database retrieval system