KEGG   Pseudomonas putida KT2440: PP_1621Help
Entry
PP_1621           CDS       T00114                                 

Gene name
pcm
Definition
(RefSeq) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ppu  Pseudomonas putida KT2440
Brite
Enzymes [BR:ppu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     PP_1621 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_31 Methyltransf_25 Methyltransf_11 NodS Methyltransf_23 Methyltransf_24 DREV
Motif
Other DBs
NCBI-GeneID: 1044857
NCBI-ProteinID: NP_743778
UniProt: Q88MF0
Position
1816857..1817552
Genome map
AA seq 231 aa AA seqDB search
MAGGPALMREDDMLRRGIGMTSQRTRERLIQRLCEEGVSNTKVLDVIRRTPRHLFVDEAL
AHRAYEDTALPIGHNQTISQPFMVAHMSELLLEAGPLDKVLEIGTGSGYQTAILAQLVER
VFSVERIKVLQDRAKERLVELNLRNVVFRWGDGCEGWPALAPYNGIIVTAVAPEVPQALL
DQLAPGGRMVIPVGPAGEAQQLMLIVREEHGFSRRVLGAVRFVPLLNGPLA
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
ttggctggagggcctgctctgatgcgtgaggacgatatgctgcggcgtggcatcggcatg
acctctcagcgtacccgggagcggctgatccagcgcttgtgcgaagagggggtttcgaac
accaaggtgctcgacgtgatccgtcgtacgccgcgccacctgttcgtcgacgaggcgctg
gcgcatcgggcttacgaagacaccgcgctgccgatcggccacaaccagaccatctcccag
ccgttcatggttgctcacatgagcgagttgttgctcgaggccgggccgctggacaaggtg
ctggagattggcaccggttcgggctaccagacggcgatcctggcccagctggtcgagcga
gtgttttcggtagagcgtatcaaggtactgcaggaccgggccaaagagcgcctggtggag
cttaacctgcgcaacgtggtcttccgctggggtgacggttgtgaggggtggccggcgctt
gcgccgtacaacggcatcatcgtcaccgccgtggcgccggaagtgccacaggcactgctc
gaccaactggcacccggtgggcgcatggtcatcccggtagggccggccggcgaagcgcag
caactgatgctgatcgtgcgcgaggagcatggattctcccgtcgggtactgggggctgtg
cgtttcgtgccgctgctcaatggtcccctggcctga

DBGET integrated database retrieval system