KEGG   Pseudomonas putida KT2440: PP_1686Help
Entry
PP_1686           CDS       T00114                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ppu  Pseudomonas putida KT2440
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ppu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PP_1686
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PP_1686
Enzymes [BR:ppu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PP_1686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1879204..1879812
Genome map
AA seq 202 aa AA seqDB search
MCVRRYPASSRIVMREKRVMRAHWLTVPVLALLASTSSWAADCPALLQGSLPELRGKGQV
DLCERFAGKPLVVVNTASYCGFAPQFEGLEATYKEYHEQGLEMLGVPSNDFKQEDADSEK
TAKVCYANYGVTFTMTKTQAVRGKDAIPLFAELASQSSAPKWNFYKYVVDRKGKVIGNFS
SLTKPDDPAFRAAIEKAIASQP
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtgtgtgttaggcgctaccctgcaagctcaaggattgtcatgcgggagaaacgagtcatg
cgtgcacattggttgacggtgccggtgctggccctgcttgccagtacatcgagctgggct
gcagattgccctgcgttgttgcagggcagcctgccggagttgcgcggtaaggggcaggtc
gacctctgcgagcgctttgccggcaagccgctcgtggtggtgaacactgccagttattgc
ggttttgccccgcagttcgaggggcttgaggcgacctacaaggagtatcacgagcaaggc
ctggaaatgctcggcgtgccgtccaatgacttcaagcaggaagacgccgacagtgagaag
actgccaaggtttgctatgccaactacggtgtcaccttcaccatgaccaagacacaggcg
gtgcggggcaaggatgcgataccgctgtttgcggagctggccagccaaagcagtgcgccg
aagtggaatttctacaagtatgttgtcgatcgcaagggcaaggtgatcggtaacttctcc
agcctgaccaaaccggatgatcccgcgttccgcgctgctatcgaaaaggccattgcctca
cagccgtga

DBGET integrated database retrieval system