KEGG   Pseudomonas putida KT2440: PP_1832Help
Entry
PP_1832           CDS       T00114                                 

Definition
oxidase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
ppu  Pseudomonas putida KT2440
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:ppu00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2057245..2057781
Genome map
AA seq 178 aa AA seqDB search
MSILSVFHPASPALPNKVLTHHDDIAATLAEQGVRFVHAEPGLRVRPGTAQDEVLEVCRV
YLDELMTAHGSKALALLNRDGEDPAQVDVRDEHVHDADELFAVVSGRAQVGLRLGDWVYS
VLCEKGDQLLVPAGTRRWVELGDTPFCLALRLYGSEQGMQARFTGDVTARAFLGIDEL
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgagcattctcagcgttttccaccccgccagcccggcactgccgaacaaggtgctgact
caccacgacgacatcgccgctacgttggccgagcagggcgtgcgctttgtgcatgccgaa
cctggcctgcgggtgcgcccgggcacggcccaggacgaggtgctggaggtttgccgcgtg
tatctggatgagttgatgacggcgcatggcagcaaggccctcgcgctgctcaaccgcgac
ggagaagacccggcacaggtcgatgtgcgtgatgaacatgtgcatgatgccgacgagctg
tttgccgtggtcagcgggcgggcgcaggttggcctgcggctgggggactgggtgtattcg
gtgctgtgcgagaagggtgaccagctgctggtgccggccgggacgcggcgctgggttgag
ttgggtgatacaccgttttgcctggcgttgcgcttgtatggcagcgagcagggcatgcag
gcgcggtttacgggcgatgtgactgcgcgggcatttcttggtatcgacgagctgtaa

DBGET integrated database retrieval system