KEGG   Pseudomonas putida KT2440: PP_1872Help
Entry
PP_1872           CDS       T00114                                 

Gene name
alaA
Definition
(RefSeq) glutamate-pyruvate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ppu  Pseudomonas putida KT2440
Pathway
ppu00220  Arginine biosynthesis
ppu00250  Alanine, aspartate and glutamate metabolism
ppu00290  Valine, leucine and isoleucine biosynthesis
ppu01100  Metabolic pathways
ppu01110  Biosynthesis of secondary metabolites
ppu01130  Biosynthesis of antibiotics
ppu01210  2-Oxocarboxylic acid metabolism
ppu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ppu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PP_1872 (alaA)
   00290 Valine, leucine and isoleucine biosynthesis
    PP_1872 (alaA)
   00220 Arginine biosynthesis
    PP_1872 (alaA)
Enzymes [BR:ppu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     PP_1872 (alaA)
    2.6.1.66  valine---pyruvate transaminase
     PP_1872 (alaA)
Amino acid related enzymes [BR:ppu01007]
 Aminotransferase (transaminase)
  Class I
   PP_1872 (alaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Costars
Motif
Other DBs
NCBI-GeneID: 1043224
NCBI-ProteinID: NP_744027
UniProt: Q88LQ7
Position
complement(2095266..2096477)
Genome map
AA seq 403 aa AA seqDB search
MQFSKSNKLANVCYDIRGPVLKHAKRLEEEGHRILKLNIGNPAPFGFEAPDEILQDVIRN
LPTAQGYSDSKGLFSARKAVMQYCQQKDIEGVTIEDIYLGNGVSELIVMSMQALLNNGDE
VLIPAPDYPLWTAAVSLAGGKPVHYLCDEQADWFPDLEDIKAKITPNTKALVIINPNNPT
GAVYSKELLLGMLELARQHNLVVFSDEIYDKILYDEAVHISTASLAPDLLCLTFNGLSKS
YRVAGFRSGWLIISGPKHHAHSYIEGIDMLANMRLCANVPAQHAIQTALGGYQSINDLVL
PPGRLLEQRNRTYELLNDIPGVSCVKPMGALYAFPRIDPKVCPILNDEKFALDLLLSEKL
LIVQGTAFNWPWPDHFRVVTLPRVDDLEAAIGRIGNFLKGYSQ
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcagttcagcaaatcgaacaagctcgccaatgtctgctacgacattcgcggcccagtg
ctcaagcacgccaaacgcctggaggaggaaggccaccgcatcctcaagctgaacatcggc
aacccggcgccgtttggcttcgaggcgcctgatgaaatccttcaggatgtgatccgcaac
ctgcccaccgcacagggctacagcgactccaaaggcctgttcagtgcccgcaaggcggtg
atgcagtactgccagcagaaagatatcgaaggcgtcaccatcgaggacatctacctgggt
aatggtgtgtccgagctgatcgtcatgtcgatgcaggcgctgctcaacaacggcgacgaa
gtgctgatcccggcccccgactacccgctgtggactgccgccgtgagcctggccggcggc
aagccggtgcactacctgtgcgacgagcaggccgactggttccctgaccttgaggacatc
aaggccaagatcaccccgaacaccaaggcgctggtgatcatcaacccgaacaacccgacc
ggcgccgtctactccaaagaactgctgctgggcatgctggagctggcccgccagcacaac
ctggtggtgttctccgacgagatctacgacaagatcctgtacgacgaagccgtgcacatc
agcaccgcctcgctggctccggacctgctgtgcctgaccttcaacggcttgtccaagtcg
taccgggtggcgggcttccgctctggctggctgatcatttccgggcccaagcaccacgca
cacagctacatcgaaggcatcgacatgctggccaacatgcgcctgtgcgccaacgtgccg
gcccagcatgccatccagaccgcgctgggcggctaccagagcatcaacgacctggtgctg
ccgccgggccgcctgctggagcagcgcaaccgcacctacgaactgctcaacgacatccct
ggcgtcagctgcgtgaaaccgatgggcgcgctgtatgcgttcccgcggatcgacccgaag
gtttgcccgatcctcaacgacgagaagttcgcccttgacctgctgctgtcggagaagctg
ctgatcgtacaagggacggcgttcaactggccgtggccggaccacttccgcgtggtgacc
ttgccgcgggtggatgacctggaagcggcaattggccggatcggcaatttcctgaagggt
tattcgcagtag

DBGET integrated database retrieval system