KEGG   Pseudomonas putida KT2440: PP_2037Help
Entry
PP_2037           CDS       T00114                                 

Definition
(RefSeq) aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
ppu  Pseudomonas putida KT2440
Pathway
ppu00051  Fructose and mannose metabolism
ppu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ppu00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    PP_2037
Enzymes [BR:ppu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     PP_2037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-GeneID: 1042879
NCBI-ProteinID: NP_744187
UniProt: Q88L98
Position
complement(2315169..2315951)
Genome map
AA seq 260 aa AA seqDB search
MTTTMHTPKDQLVKLAQQQMLTALTDNTYTVRQKLALTCRILFDGGHDSGLAGQITARAQ
EPGTYYTQQLGLGFDEIAASNLLVVDEDLTVLQGHGMANPANRFHSWLYRARPDVNCIIH
THPLHSAALSMLEVPLAISHMDLCPLFDDCAFLKEWPGVPVGNEEGEIIANAIGDKRAIL
LSHHGLLIAGRSIEEACVLALLFERAAKMQLLAMGAGDIRPIPEALGKEAHDWISTPKRH
GAAFSYYARRALRAHGDCLG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccaccatgcacacccccaaggaccagcttgtcaaactcgcccagcaacagatg
ctgacggcgctgaccgacaacacctacaccgtgcgacaaaaactcgccctcacctgccgt
atcctgttcgacggcggccacgactctggcctggccgggcagatcactgcgcgtgcgcag
gagcctggcacctactacacccaacaactggggcttggcttcgacgaaatcgccgcttcc
aacctgctggtggtggacgaagacctgacggtgctgcaaggccatggcatggccaacccg
gccaaccgcttccacagctggctgtaccgcgcccgccccgacgtcaactgcatcatccac
acccacccgctgcacagcgccgccttgtcgatgctggaagttccgctggccatctcgcac
atggacctgtgccccctgttcgacgactgtgcattcctcaaggaatggcccggtgtaccg
gtgggcaacgaagaaggcgaaatcatcgcgaacgcgattggcgacaagcgcgcaatcctg
ctttcccatcatggcctgctgatcgctgggcgttcgatcgaggaagcctgcgtgctcgct
ctgctgttcgagcgcgcagcaaagatgcaactgctggccatgggcgccggtgacatccgc
cccatccccgaagcactgggcaaagaggcccacgactggatttccacccccaaacgtcac
ggtgctgccttcagctactacgcgcgccgtgccttgcgtgcccatggcgactgcctgggc
tga

DBGET integrated database retrieval system