KEGG   Pseudomonas putida KT2440: PP_2037Help
Entry
PP_2037           CDS       T00114                                 

Definition
class II aldolase/adducin domain-containing protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
ppu  Pseudomonas putida KT2440
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ppu00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(2315166..2315948)
Genome map
AA seq 260 aa AA seqDB search
MTTTMHTPKDQLVKLAQQQMLTALTDNTYTVRQKLALTCRILFDGGHDSGLAGQITARAQ
EPGTYYTQQLGLGFDEIAASNLLVVDEDLTVLQGHGMANPANRFHSWLYRARPDVNCIIH
THPLHSAALSMLEVPLAISHMDLCPLFDDCAFLKEWPGVPVGNEEGEIIANAIGDKRAIL
LSHHGLLIAGRSIEEACVLALLFERAAKMQLLAMGAGDIRPIPEALGKEAHDWISTPKRH
GAAFSYYARRALRAHGDCLG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccaccatgcacacccccaaggaccagcttgtcaaactcgcccagcaacagatg
ctgacggcgctgaccgacaacacctacaccgtgcgacaaaaactcgccctcacctgccgt
atcctgttcgacggcggccacgactctggcctggccgggcagatcactgcgcgtgcgcag
gagcctggcacctactacacccaacaactggggcttggcttcgacgaaatcgccgcttcc
aacctgctggtggtggacgaagacctgacggtgctgcaaggccatggcatggccaacccg
gccaaccgcttccacagctggctgtaccgcgcccgccccgacgtcaactgcatcatccac
acccacccgctgcacagcgccgccttgtcgatgctggaagttccgctggccatctcgcac
atggacctgtgccccctgttcgacgactgtgcattcctcaaggaatggcccggtgtaccg
gtgggcaacgaagaaggcgaaatcatcgcgaacgcgattggcgacaagcgcgcaatcctg
ctttcccatcatggcctgctgatcgctgggcgttcgatcgaggaagcctgcgtgctcgct
ctgctgttcgagcgcgcagcaaagatgcaactgctggccatgggcgccggtgacatccgc
cccatccccgaagcactgggcaaagaggcccacgactggatttccacccccaaacgtcac
ggtgctgccttcagctactacgcgcgccgtgccttgcgtgcccatggcgactgcctgggc
tga

DBGET integrated database retrieval system