KEGG   Pseudomonas putida KT2440: PP_2136Help
Entry
PP_2136           CDS       T00114                                 

Gene name
fadB
Definition
(RefSeq) enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
ppu  Pseudomonas putida KT2440
Pathway
ppu00071  Fatty acid degradation
ppu00280  Valine, leucine and isoleucine degradation
ppu00281  Geraniol degradation
ppu00310  Lysine degradation
ppu00362  Benzoate degradation
ppu00380  Tryptophan metabolism
ppu00410  beta-Alanine metabolism
ppu00640  Propanoate metabolism
ppu00650  Butanoate metabolism
ppu00903  Limonene and pinene degradation
ppu00930  Caprolactam degradation
ppu01040  Biosynthesis of unsaturated fatty acids
ppu01100  Metabolic pathways
ppu01110  Biosynthesis of secondary metabolites
ppu01120  Microbial metabolism in diverse environments
ppu01130  Biosynthesis of antibiotics
ppu01200  Carbon metabolism
ppu01212  Fatty acid metabolism
Module
ppu_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ppu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PP_2136 (fadB)
   00650 Butanoate metabolism
    PP_2136 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    PP_2136 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    PP_2136 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PP_2136 (fadB)
   00310 Lysine degradation
    PP_2136 (fadB)
   00380 Tryptophan metabolism
    PP_2136 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PP_2136 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PP_2136 (fadB)
   00281 Geraniol degradation
    PP_2136 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PP_2136 (fadB)
   00930 Caprolactam degradation
    PP_2136 (fadB)
Enzymes [BR:ppu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     PP_2136 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PP_2136 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     PP_2136 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     PP_2136 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 SDH_sah
Motif
Other DBs
NCBI-GeneID: 1044991
NCBI-ProteinID: NP_744285
UniProt: Q88L02
Position
2437081..2439228
Genome map
AA seq 715 aa AA seqDB search
MIYEGKAITVKALESGIVELKFDLKGESVNKFNRLTLNELRQAVDAIRADASVKGVIVRS
GKDVFIVGADITEFVDNFKLPEAELVAGNLEANRIFNAFEDLEVPTVAAINGIALGGGLE
MCLAADYRVMSTSARIGLPEVKLGIYPGFGGTVRLPRLIGSDNAIEWIAAGKENRAEDAL
KVGAVDAVVAPELLLAGALDLIKRAISGELDYKAKRQPKLEKLKLNAIEQMMAFETAKGF
VAGQAGPNYPAPVEAIKSIQKAANFGRDKALEVEAAGFAKLAKTSVAESLIGLFLNDQEL
KRKAKAHDEIAHDVKQAAVLGAGIMGGGIAYQSAVKGTPILMKDIREEAIQLGLNEASKL
LGNRVEKGRLTPAKMAEALNAIRPTLSYGDFANVDIVVEAVVENPKVKQAVLAEVEGQVK
DDAILASNTSTISINLLAKALKRPENFVGMHFFNPVHMMPLVEVIRGEKSSDVAVATTVA
YAKKMGKNPIVVNDCPGFLVNRVLFPYFGGFAKLVSAGVDFVRIDKVMEKFGWPMGPAYL
MDVVGIDTGHHGRDVMAEGFPDRMKDERRSAVDALYEANRLGQKNGKGFYAYETDKRGKP
KKVFDATVLDVLKPIVFEQREVTDEDIINWMMVPLCLETVRCLEDGIVETAAEADMGLVY
GIGFPPFRGGALRYIDSIGVAEFVALADQYADLGPLYHPTAKLREMAKNGQRFFN
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgaaggtaaagccatcacggttaaggctcttgaaagtggcatcgtcgagctc
aagttcgacctcaagggtgagtccgtcaacaagttcaaccgccttaccctgaacgagctg
cgccaggccgtcgatgccatccgggccgatgcttcggtcaagggcgtgatcgtcaggagt
ggcaaggacgtgttcatcgtcggcgccgacatcaccgagttcgtcgacaacttcaagctg
cctgaggccgaactggtcgctggcaacctggaagccaatcgcatcttcaacgcgttcgaa
gacctcgaagtgccgaccgttgccgccatcaacggcatcgcgctgggcggcggcctggaa
atgtgcctggcggccgactaccgggtcatgtccaccagcgccaggatcggcctgccggaa
gtcaagctgggtatctacccgggctttggcggtaccgtgcgcctgccgcgcctgatcggc
tcggacaacgccatcgagtggatcgccgccggcaaggaaaaccgtgccgaagatgccctg
aaagtgggggccgtcgacgccgtggtcgcccctgagctgctgctggccggtgccctcgac
ctgatcaagcgtgccatcagtggcgagctggactacaaggccaagcgccagccgaagctg
gaaaagctcaagctcaatgccatcgagcagatgatggccttcgagactgccaagggcttc
gtcgctggccaggccggcccgaactacccggccccggtcgaagcgatcaagagcatccag
aaagccgccaacttcggtcgcgacaaggccctggaagtcgaagccgcaggctttgccaag
ctggccaagacctctgtcgccgagagcctgatcggcttgttcctcaacgatcaggaactc
aagcgcaaggccaaggcgcatgacgagatcgcccacgacgtgaagcaggccgccgtgctc
ggcgccggcatcatgggcggcggtatcgcctaccagtcggcggtcaaaggtacgccgatc
ctgatgaaggacatccgcgaggaagccattcagctgggtctgaacgaggcctccaagttg
cttggcaaccgcgtcgagaagggccgcctgaccccggccaagatggccgaggccctcaac
gccattcgcccgaccctgtcctatggcgatttcgccaatgtcgacatcgtcgtcgaggct
gtggtcgagaacccgaaggtcaagcaagcggtactggcggaagtggaaggccaggtgaag
gacgatgcgatcctcgcttccaacacctctaccatctccatcaacctgctggccaaggcg
ctcaagcgcccggaaaacttcgtcggcatgcacttcttcaacccggtgcacatgatgccg
ctggttgaagtgatccgtggcgagaagtccagtgacgtggcggtcgccaccaccgtggcc
tacgccaagaaaatgggcaagaacccgatcgtggtcaacgactgcccgggctttttggtc
aaccgcgtgctgttcccgtactttggcggttttgccaagctggtcagcgccggtgtcgac
ttcgtgcgcatcgacaaggtcatggagaagttcggctggccgatgggcccagcctacttg
atggacgtggtcggcatcgacaccggccaccacggccgtgacgtcatggccgaaggcttc
ccggatcgcatgaaggacgagcgccgctcggcagtcgacgcgttgtacgaggccaaccgc
ctgggccagaagaacggtaagggcttctacgcctacgaaaccgacaagcgcggcaagccg
aagaaggtcttcgatgccaccgtgctcgacgtgctcaaaccgatcgtgttcgagcagcgt
gaagtcactgacgaagacatcatcaactggatgatggtcccgctgtgccttgagaccgtg
cgttgcctggaagacggcatcgtcgaaaccgctgccgaagccgacatgggcctggtctac
ggcattggtttccctcccttccgcggtggtgcgctgcgttacatcgactcgatcggtgtg
gccgaattcgtcgccctggccgatcagtatgccgacctggggccgctgtaccacccgacc
gccaagctgcgtgaaatggccaagaacggccagcgcttcttcaactga

DBGET integrated database retrieval system