KEGG   Pseudomonas putida KT2440: PP_2145Help
Entry
PP_2145           CDS       T00114                                 

Gene name
nagZ
Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ppu  Pseudomonas putida KT2440
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PP_2145 (nagZ)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    PP_2145 (nagZ)
Enzymes [BR:ppu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PP_2145 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2446609..2447619
Genome map
AA seq 336 aa AA seqDB search
MTVSLQGSLMVDIAGKWLTAEDRQLLRQPEVAGLIIFARNIDNPRQVRELCASIRAIRPD
LILAVDQEGGRVQRLRQGFVRLPAMRALADNDNAEYLAEQCGWLMATEVLAVGLDLSFAP
VLDLDHQRSAVVGSRAFEGDPLLATRLAGAFIRGMNAAGMAACGKHFPGHGWAEADSHVA
IPTDERSLEQLRQSDLVPFTRLSGQLAAVMPAHVIYPQVDNQPAGFSRRWLQDILRGELG
FDGVIFSDDLSMAGAHVVGDAASRIEAALSAGCDMGLVCNDRAAAELALSAAQRMKVKPS
PRIARMRGQGFARTDYRQQPRWLEALGALKEAQLVD
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgactgtcagcctgcaaggctccctgatggtggatatcgccggtaaatggctgaccgcc
gaagaccgtcaactgcttcgccagccggaagtggctggcctgatcatcttcgcccgcaat
atcgacaacccgcgccaggttcgcgaactgtgcgcgtccatccgcgccattcgccccgat
ctgatcctggcagtggaccaggaaggcgggcgcgtacagcgtctgcgccagggctttgtg
cgcctgccggccatgcgtgcgctggccgataacgacaatgccgagtatctggctgagcag
tgcggctggctgatggcgaccgaggtgctggcggttggcctggacctcagcttcgctccg
gtgctcgacctggaccaccagcgtagcgccgtggtgggcagccgcgcgttcgagggtgac
ccgctgcttgcaacgcgcctggccggcgcgttcatccgtggcatgaatgcggcgggtatg
gccgcctgtggcaagcatttcccggggcatggctgggccgaagccgattcgcacgtggcc
atccccactgatgaacgcagcctggaacaactgcgccagtccgacctggtgccgtttacc
cgcctgagtgggcaactggcggcagtgatgccggcgcatgtcatctacccgcaggttgac
aaccagcccgctggcttctcgcggcgttggttgcaggacatcctgcgtggcgagctgggc
tttgatggggtgattttcagtgatgacctgtcgatggccggtgcgcatgtggtgggcgac
gcggccagccgtatcgaggcggcgctgagcgccggttgtgatatgggcctggtgtgcaat
gaccgggcggcggcggagctggcgctgagtgcggcgcagcgcatgaaggtcaagccatcg
ccgcggattgcgcggatgcgtgggcaagggtttgcgcgaaccgattatcgccagcagccg
cgctggctggaggcgttgggggcgttgaaggaagctcagctggtcgattga

DBGET integrated database retrieval system