KEGG   Pseudomonas putida KT2440: PP_2196Help
Entry
PP_2196           CDS       T00114                                 

Gene name
speB
Definition
(RefSeq) agmatinase
  KO
K01480  
agmatinase [EC:3.5.3.11]
Organism
ppu  Pseudomonas putida KT2440
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PP_2196 (speB)
Enzymes [BR:ppu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     PP_2196 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
2502706..2503641
Genome map
AA seq 311 aa AA seqDB search
MTRDSLYGTAAESTYAGVVSFSRRRYSRDLRGVDVVVSGVPFDTATSNRPGARFGPRAIR
AASVQQAWARHWPWAFDPFDHLAVIDYGDCPFDSGTPQSVPDSIEAHAEHILQAGCAMLT
LGGDHFISYPLLKAHARRHGPLALIHFDAHSDTWPDEAGKRIDHGTMFWHAAREGLVDPA
HSVQIGLRTTNDDSQGFAILDARQVHRQGTEAVIAAIRQRVGERPVYLTFDIDCLDPAYA
PGTGTPVCGGLSTVQALEILGGLRGINLVGMDLVEVAPAYDHADITALAGATLAMEMLCL
YAARHKVDNGQ
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcgatagcctgtatggtaccgccgcagaaagcacctacgctggtgttgtcagt
ttctcccgccgccgctacagccgcgacttgcgcggtgtggatgtggtggtcagcggtgtg
ccgttcgacacggccaccagtaaccgccccggcgcgcgcttcggcccgcgggcgatccgt
gctgcctcggtccagcaggcctgggcccgccactggccgtgggcgttcgacccgttcgac
cacctggcggtcatcgactatggcgactgtcccttcgacagcggcacgccgcagtcggta
ccggacagcatcgaggcccatgccgagcacattctgcaggcgggttgcgccatgctgacc
cttggtggcgaccacttcatcagctacccgctgctcaaggctcacgcccgccgccatggc
ccgctggcgctgatccatttcgatgcgcacagtgacacctggccggacgaggcgggcaag
cgcatcgaccacggcaccatgttctggcatgccgcccgcgaaggcctggttgaccccgcc
cactcggtgcagattggcctgcgcacgaccaatgacgacagccagggctttgccattctc
gacgccaggcaagtgcaccgccagggcacagaggcggtgattgcagcgattcgccagcgg
gtgggcgagcggccggtgtacttgaccttcgacatcgactgcctcgatccggcctacgcg
cccggtaccggaacgccggtgtgtggcgggctgagcacggtgcaggcgctggagattctg
ggtgggctgcgtggcatcaacctggtaggcatggacttggtggaagtggcgccagcctat
gaccatgccgatatcaccgcgttggccggggcaaccctggccatggagatgctgtgcctg
tatgcggcgcggcacaaggtggacaacggccagtag

DBGET integrated database retrieval system