KEGG   Pseudomonas putida KT2440: PP_2213Help
Entry
PP_2213           CDS       T00114                                 

Gene name
fadDx
Definition
AMP-dependent synthetase/ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ppu  Pseudomonas putida KT2440
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ppu01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ppu00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ppu00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ppu00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:ppu00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2523276..2524961
Genome map
AA seq 561 aa AA seqDB search
MLQLQKQETRSPMMRDYAEAARTFDHDQAVVTALHGNLEALNACVECCDRHAGDGKLALI
HEDRDGNSACYSFDQLQVQAARFANVLKAQGVGAGDRVAGLMPRTPELLVTILATWRLGA
VYQPLFTAFGPKAIEHRLEQSHARVVVTDSHNRAKLDDVHACPTIITVKARSGELDFQQC
LERAADVCEPVMRSGNDPFLLMFTSGTTGPAKPLEVPLRAIVAFQGYMRDAIELLPEDNF
WNLADPGWAYGLYYAVTGPLSLGHATTFYDGPFSVESCARVIDKLGITNLAGSPTAYRLL
IAAGKDFSAPIKGRLRVVSSAGEPLNPEVIRWFADELGVTIHDHYGQTELGMVLCNHHGL
QHPVHLGSAGYAIPGHRIVVVDEQGNELPAGQPGILAVDREQSPLCWFGGYHGLPTKAFV
GKYYLSGDTVELNPDGSISFVGRSDDVITTSGYRVGPFDVESALIEHPAVIEAAVIGKPD
PERTELIKAFVVLASGYAGSVELEETLRQHVRQRLYAHAYPREIEFVSELPKTPSGKLQR
FILRNQEVAKQQAQQATPASV
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaactccaaaaacaagaaaccaggagtccgatgatgcgcgattacgccgaggcc
gctcgtacgttcgaccatgaccaggccgttgtgacggcattgcacggcaaccttgaagcc
cttaatgcctgtgtcgaatgctgtgaccggcatgccggtgacggcaagctggcactgatt
catgaggaccgcgatggtaacagcgcgtgctatagcttcgatcagcttcaggtgcaggct
gctcggttcgccaatgtgttaaaggcgcagggggtaggcgccggagaccgggttgccggc
ttgatgccgcgtacccctgaactgctggtgaccatcctcgctacctggcgcctcggggcg
gtttaccagcccttgttcaccgcgttcggccccaaggccatcgagcaccggcttgagcaa
tcccatgcccgagtggtggtcaccgatagccacaaccgcgccaagctggacgatgtgcac
gcctgcccgaccatcatcactgtcaaggcccgcagtggtgagctggacttccagcaatgc
ctggaacgcgcagcggacgtatgtgagccggtgatgcgctcaggcaacgatccattcctg
ctgatgttcacttccggaaccactggcccggcaaaacccctggaagtgccactgcgtgcg
atcgtcgcgtttcagggctacatgcgtgatgccatcgagctgctgcccgaggacaacttc
tggaacctggccgacccgggttgggcttacggcttgtattacgccgttaccggtccgttg
tcgctggggcacgccaccacgttctacgatggcccgttcagtgtcgagagctgcgcccgg
gtgatcgacaagctgggtatcaccaacctggccggctcgcccaccgcgtatcgcttgctg
attgcggcgggcaaagatttctcggcaccgatcaagggccgcctgcgggtggtcagcagt
gccggcgaaccgctgaaccccgaagtgatccgctggttcgccgacgagctgggcgtgacc
attcacgatcactacggccagaccgaactgggcatggtgctgtgcaaccaccatggcctg
cagcatccggtgcacctgggttctgccggctatgccatccccggccaccgcatcgtggtg
gtggacgagcaaggtaacgaactgccagccggccagccaggcatcctcgccgttgaccgt
gagcagtcgccgctgtgctggttcggcggttaccacggcctgccgaccaaagccttcgtc
ggcaagtactacctcagcggcgacactgtcgagctgaacccggatggcagcatcagcttc
gttggccgtagcgacgacgtgatcaccacctccggttaccgtgtggggccattcgatgtg
gaaagcgcgttgatcgagcacccggcggtgatcgaggcagcggtgatcggcaagcccgac
ccggagcgtaccgagctgatcaaggcgttcgtggtattggccagcggctacgccggcagc
gtcgagctggaagaaaccttgcgccagcatgtgcgccagcgcctctacgcgcatgcctac
cccagggaaatcgaattcgtcagcgagctgcccaagaccccgagcggcaagctgcaacgc
ttcatcctgcgcaaccaggaagtcgccaaacaacaagcgcaacaggccacccctgccagc
gtctga

DBGET integrated database retrieval system