KEGG   Pseudomonas putida KT2440: PP_2213Help
Entry
PP_2213           CDS       T00114                                 

Gene name
fadDx
Definition
AMP-dependent synthetase/ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ppu  Pseudomonas putida KT2440
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PP_2213 (fadDx)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PP_2213 (fadDx)
   00620 Pyruvate metabolism
    PP_2213 (fadDx)
   00640 Propanoate metabolism
    PP_2213 (fadDx)
  Energy metabolism
   00680 Methane metabolism
    PP_2213 (fadDx)
Enzymes [BR:ppu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PP_2213 (fadDx)
Lipid biosynthesis proteins [BR:ppu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PP_2213 (fadDx)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2523276..2524961
Genome map
AA seq 561 aa AA seqDB search
MLQLQKQETRSPMMRDYAEAARTFDHDQAVVTALHGNLEALNACVECCDRHAGDGKLALI
HEDRDGNSACYSFDQLQVQAARFANVLKAQGVGAGDRVAGLMPRTPELLVTILATWRLGA
VYQPLFTAFGPKAIEHRLEQSHARVVVTDSHNRAKLDDVHACPTIITVKARSGELDFQQC
LERAADVCEPVMRSGNDPFLLMFTSGTTGPAKPLEVPLRAIVAFQGYMRDAIELLPEDNF
WNLADPGWAYGLYYAVTGPLSLGHATTFYDGPFSVESCARVIDKLGITNLAGSPTAYRLL
IAAGKDFSAPIKGRLRVVSSAGEPLNPEVIRWFADELGVTIHDHYGQTELGMVLCNHHGL
QHPVHLGSAGYAIPGHRIVVVDEQGNELPAGQPGILAVDREQSPLCWFGGYHGLPTKAFV
GKYYLSGDTVELNPDGSISFVGRSDDVITTSGYRVGPFDVESALIEHPAVIEAAVIGKPD
PERTELIKAFVVLASGYAGSVELEETLRQHVRQRLYAHAYPREIEFVSELPKTPSGKLQR
FILRNQEVAKQQAQQATPASV
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaactccaaaaacaagaaaccaggagtccgatgatgcgcgattacgccgaggcc
gctcgtacgttcgaccatgaccaggccgttgtgacggcattgcacggcaaccttgaagcc
cttaatgcctgtgtcgaatgctgtgaccggcatgccggtgacggcaagctggcactgatt
catgaggaccgcgatggtaacagcgcgtgctatagcttcgatcagcttcaggtgcaggct
gctcggttcgccaatgtgttaaaggcgcagggggtaggcgccggagaccgggttgccggc
ttgatgccgcgtacccctgaactgctggtgaccatcctcgctacctggcgcctcggggcg
gtttaccagcccttgttcaccgcgttcggccccaaggccatcgagcaccggcttgagcaa
tcccatgcccgagtggtggtcaccgatagccacaaccgcgccaagctggacgatgtgcac
gcctgcccgaccatcatcactgtcaaggcccgcagtggtgagctggacttccagcaatgc
ctggaacgcgcagcggacgtatgtgagccggtgatgcgctcaggcaacgatccattcctg
ctgatgttcacttccggaaccactggcccggcaaaacccctggaagtgccactgcgtgcg
atcgtcgcgtttcagggctacatgcgtgatgccatcgagctgctgcccgaggacaacttc
tggaacctggccgacccgggttgggcttacggcttgtattacgccgttaccggtccgttg
tcgctggggcacgccaccacgttctacgatggcccgttcagtgtcgagagctgcgcccgg
gtgatcgacaagctgggtatcaccaacctggccggctcgcccaccgcgtatcgcttgctg
attgcggcgggcaaagatttctcggcaccgatcaagggccgcctgcgggtggtcagcagt
gccggcgaaccgctgaaccccgaagtgatccgctggttcgccgacgagctgggcgtgacc
attcacgatcactacggccagaccgaactgggcatggtgctgtgcaaccaccatggcctg
cagcatccggtgcacctgggttctgccggctatgccatccccggccaccgcatcgtggtg
gtggacgagcaaggtaacgaactgccagccggccagccaggcatcctcgccgttgaccgt
gagcagtcgccgctgtgctggttcggcggttaccacggcctgccgaccaaagccttcgtc
ggcaagtactacctcagcggcgacactgtcgagctgaacccggatggcagcatcagcttc
gttggccgtagcgacgacgtgatcaccacctccggttaccgtgtggggccattcgatgtg
gaaagcgcgttgatcgagcacccggcggtgatcgaggcagcggtgatcggcaagcccgac
ccggagcgtaccgagctgatcaaggcgttcgtggtattggccagcggctacgccggcagc
gtcgagctggaagaaaccttgcgccagcatgtgcgccagcgcctctacgcgcatgcctac
cccagggaaatcgaattcgtcagcgagctgcccaagaccccgagcggcaagctgcaacgc
ttcatcctgcgcaaccaggaagtcgccaaacaacaagcgcaacaggccacccctgccagc
gtctga

DBGET integrated database retrieval system