KEGG   Pseudomonas putida KT2440: PP_2217Help
Entry
PP_2217           CDS       T00114                                 

Definition
(RefSeq) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ppu  Pseudomonas putida KT2440
Pathway
ppu00071  Fatty acid degradation
ppu00280  Valine, leucine and isoleucine degradation
ppu00281  Geraniol degradation
ppu00310  Lysine degradation
ppu00360  Phenylalanine metabolism
ppu00362  Benzoate degradation
ppu00380  Tryptophan metabolism
ppu00410  beta-Alanine metabolism
ppu00627  Aminobenzoate degradation
ppu00640  Propanoate metabolism
ppu00650  Butanoate metabolism
ppu00903  Limonene and pinene degradation
ppu00930  Caprolactam degradation
ppu01100  Metabolic pathways
ppu01110  Biosynthesis of secondary metabolites
ppu01120  Microbial metabolism in diverse environments
ppu01130  Biosynthesis of antibiotics
ppu01212  Fatty acid metabolism
Module
ppu_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ppu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PP_2217
   00650 Butanoate metabolism
    PP_2217
  Lipid metabolism
   00071 Fatty acid degradation
    PP_2217
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PP_2217
   00310 Lysine degradation
    PP_2217
   00360 Phenylalanine metabolism
    PP_2217
   00380 Tryptophan metabolism
    PP_2217
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PP_2217
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PP_2217
   00281 Geraniol degradation
    PP_2217
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PP_2217
   00627 Aminobenzoate degradation
    PP_2217
   00930 Caprolactam degradation
    PP_2217
Enzymes [BR:ppu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PP_2217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-GeneID: 1045082
NCBI-ProteinID: NP_744366
UniProt: Q88KS2
Position
2528100..2528873
Genome map
AA seq 257 aa AA seqDB search
MAFETILLDIHGKVGLITLNRPQALNALNAQIVGEINQALDQLERDPNIGCVVLTGSAKA
FAAGADIKEMAELQYPQIYVDDLFSDADRIANRRKPIIAAVSGFALGGGCELAMMCDFIL
AADNAKFGQPEINLGVLPGMGGTQRLTRAVGKAKAMELCLTGRLMGAEEAERAGLVARIV
PQAELVEEALKVAATIASKSIPVSMMVKESVNRAFEVTLSEGVRFERRVFHAAFSTEDQK
EGMAAFIAKREAQFKDR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggcattcgaaaccatcctgttggacatccacggcaaggttggcctgatcaccctcaac
cggccgcaggcgctcaatgcgctgaacgcgcagattgtcggcgagatcaaccaggctctg
gaccagctcgagcgcgacccgaacatcggctgcgtggtgctgacaggctcggccaaagcc
tttgccgctggcgccgacatcaaggaaatggccgagctgcaatacccgcagatctacgtc
gacgacctgttcagcgacgctgaccgcatcgccaatcgccgtaagccgatcattgctgct
gtgtctggatttgccttgggcggcggctgtgagctggcgatgatgtgcgactttatcctc
gctgcggacaatgccaaatttggtcaaccggaaatcaacctgggcgtgctgccgggcatg
ggcggcacccagcgcctgacgcgtgcggtgggcaaggccaaggccatggagctttgcctg
accggccgcctgatgggcgcggaagaagccgagcgtgcaggcctggtggcgcggatcgtg
ccgcaggcagagctggtggaagaggcgctgaaggtggcggcgaccattgccagcaagtcg
attccggtgagcatgatggtcaaggagagcgtcaaccgggcatttgaagtcaccctcagc
gagggggttcgctttgagcgtcgggtcttccatgcggctttctccaccgaagaccagaaa
gaaggcatggccgcattcatcgccaagcgtgaggcacagttcaaggaccgttga

DBGET integrated database retrieval system