KEGG   Pseudomonas putida KT2440: PP_2318Help
Entry
PP_2318           CDS       T00114                                 

Definition
GDSL family lipase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ppu  Pseudomonas putida KT2440
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:ppu00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PP_2318
Enzymes [BR:ppu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PP_2318
   3.1.2  Thioester hydrolases
    3.1.2.-  
     PP_2318
Lipid biosynthesis proteins [BR:ppu01004]
 Fatty acid synthase
  Component type
   PP_2318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2648013..2648618
Genome map
AA seq 201 aa AA seqDB search
MRVWWLSAGLALYCLAQSAAAGTLLVVGDSISAGFGLDSRQGWVSLLQARLRDEGFDEKV
VNASISGDTSAGGQARLPALLAAHKPSLVVLELGGNDGLRGQSPAQLQQNLASMIERSRQ
AGAKVLLLGMRLPPNYGVRYTTAFAKVYEQLAADKQVPLVPFFLEGVGGVPELMQADGIH
PAQGAQQRLLENAWPAIKPLL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcgagtgtggtggttgagtgccggtctggccctgtattgcctggcccagagcgcagcg
gcaggaacactgctggttgttggcgatagtatcagcgccggttttggcctggatagccgt
cagggctgggtgtctctcttgcaggcccgcctcagggacgaaggttttgacgaaaaagtg
gtcaatgcttcgatcagtggcgataccagcgcaggtggacaggcgcggctgccggcgctg
cttgcagcacataaaccaagcctggtggtgctggagctgggcggcaacgatggcctgcgc
gggcagtcgcccgcacaattgcaacaaaatcttgcctcgatgatcgagcgttcgcgtcag
gcaggggccaaggtgctgttattgggcatgcgcctgccgcccaattatggtgtgcgttac
accaccgcctttgccaaggtgtatgaacagctggcagcggacaaacaggttcctttggtg
ccgtttttcctcgaaggggtagggggagtgcctgaactgatgcaggctgatggcatccat
ccggcccagggggctcagcagcgcctgctggaaaatgcctggccagcgataaaacccttg
ctgtga

DBGET integrated database retrieval system