KEGG   Pseudomonas putida KT2440: PP_2318Help
Entry
PP_2318           CDS       T00114                                 

Definition
GDSL family lipase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ppu  Pseudomonas putida KT2440
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:ppu01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2648013..2648618
Genome map
AA seq 201 aa AA seqDB search
MRVWWLSAGLALYCLAQSAAAGTLLVVGDSISAGFGLDSRQGWVSLLQARLRDEGFDEKV
VNASISGDTSAGGQARLPALLAAHKPSLVVLELGGNDGLRGQSPAQLQQNLASMIERSRQ
AGAKVLLLGMRLPPNYGVRYTTAFAKVYEQLAADKQVPLVPFFLEGVGGVPELMQADGIH
PAQGAQQRLLENAWPAIKPLL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcgagtgtggtggttgagtgccggtctggccctgtattgcctggcccagagcgcagcg
gcaggaacactgctggttgttggcgatagtatcagcgccggttttggcctggatagccgt
cagggctgggtgtctctcttgcaggcccgcctcagggacgaaggttttgacgaaaaagtg
gtcaatgcttcgatcagtggcgataccagcgcaggtggacaggcgcggctgccggcgctg
cttgcagcacataaaccaagcctggtggtgctggagctgggcggcaacgatggcctgcgc
gggcagtcgcccgcacaattgcaacaaaatcttgcctcgatgatcgagcgttcgcgtcag
gcaggggccaaggtgctgttattgggcatgcgcctgccgcccaattatggtgtgcgttac
accaccgcctttgccaaggtgtatgaacagctggcagcggacaaacaggttcctttggtg
ccgtttttcctcgaaggggtagggggagtgcctgaactgatgcaggctgatggcatccat
ccggcccagggggctcagcagcgcctgctggaaaatgcctggccagcgataaaacccttg
ctgtga

DBGET integrated database retrieval system