KEGG   Pseudomonas putida KT2440: PP_2458Help
Entry
PP_2458           CDS       T00114                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ppu  Pseudomonas putida KT2440
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ppu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PP_2458 (rbsK)
Enzymes [BR:ppu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PP_2458 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2805223..2806131
Genome map
AA seq 302 aa AA seqDB search
MNAKVVVVGSLNMDLVVRAQRLPRAGETLPGDSFFTVPGGKGANQAVAVARLGGSVAMIG
NVGDDDYGRQLHRALYVEGIDCQGVSTCPAMSSGVALITVDAASQNCIVIIPGANGLLTP
QSVRRFDALLQAAEVIICQLEVPASTVAWTLARGHELGKQVILNPAPATGPLPADWFAHI
DYLTPNESEAEALTGVVVTDQDSARRAGERLLQLGAGKVIITLGAQGALLVTAQGHQHYP
APHVQPLDTTAAGDTFIGGFAAGLVRGLEEGEAIAFGQRAAALSVTRAGAQPSIPYLAEL
TP
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccaaggttgtggtggttggcagcctcaacatggacctggtggtccgcgcccag
cgcctgccgcgggccggcgaaacactccccggcgatagctttttcacggtgccgggcggc
aagggtgccaaccaggcggtggcagtggcgcggctgggcggcagcgtggctatgatcggc
aatgtgggggatgacgactacgggcggcaactgcaccgggccttgtatgtcgaggggatc
gactgtcagggcgtcagcacctgtccagccatgtccagcggtgtggcgctgatcacggtg
gatgctgccagccagaactgtattgtcatcattcccggcgccaacggcctgctgacgccg
cagtcggtgcggcgcttcgatgcgttgctgcaggctgccgaggtaatcatctgccagttg
gaagtgccagccagcaccgtggcctggacactggccagagggcacgagctgggcaagcag
gtgatcctgaacccagcacccgctaccggccccttgccagcggactggtttgcgcatatc
gattaccttacccctaacgaaagtgaggccgaagccttgaccggtgtggtggtgaccgac
caggacagtgcccggcgcgcgggcgagcgcttgctgcagctgggggcaggcaaagtgatc
atcaccttgggtgcgcaaggtgccttgctggttactgcccaaggtcatcagcactatccg
gcgccgcacgtgcaaccgctggacaccaccgctgccggcgataccttcatcggtggcttt
gctgccggcctggtgcgtgggctggaggagggggaggcgatcgcctttggccagcgtgct
gcagcattgtcggttacccgtgccggtgcccaaccgtcgattccctacctggcagagctg
acgccatga

DBGET integrated database retrieval system