KEGG   Pseudomonas putida KT2440: PP_2637Help
Entry
PP_2637           CDS       T00114                                 

Definition
(RefSeq) endo-1,4-D-glucanase (EC:3.2.1.4)
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
ppu  Pseudomonas putida KT2440
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
3018360..3019472
Genome map
AA seq 370 aa AA seqDB search
MRQMLVGLVALGLPVFANAGSVCPWPAWERFKAELVSVDGRVIDPSDERLITTSEGQSYA
LFFALVGNDRQTFAQLLRWTSNNLAEGDLARHLPAWLWGRDGQQQWQVLDANNASDADLW
IAYSLLEAGRLWDQPAYTQLGQHLLWRIAAQTVRKLPGLGVMLLPGDYGFEDAQGTRLNP
SYLPLQLLDRFSDVDPLWGELAANTRRLWLASSPKGFAPDWLLWTPAGKPAADTKHGNAG
DYDAIRVYLWVGMLAEGAAQRRELVAHYAPMAALTQRQGLPPEHLDARSGEARGHGPAGF
SAALLPLLAASPEHVAGLAAQRQRLREQPVEAKAYYSQVLALFGQGFDEARYRFDPHGRL
LPAWSAPCSE
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgcgccagatgctggtagggctggtcgccttaggcctgcccgttttcgccaatgccggg
tcggtttgcccatggcctgcctgggagcggttcaaggccgagctggtgagtgtggatggg
cgggtcatcgacccgagtgacgagcgcctgatcaccacctcggaagggcagagttacgcg
ctgttcttcgccctggtaggtaacgaccggcaaaccttcgcgcagttgctgcgttggacc
agcaacaacctcgccgagggtgacctggcccggcatctgcctgcctggctgtggggccgt
gacgggcagcagcagtggcaggtgctggacgccaacaacgccagcgatgccgatctgtgg
atcgcctacagcctgctggaagcagggcggttgtgggaccagccggcctacacgcaactg
ggccagcacctgctgtggcgtatcgccgcgcagaccgtgcgcaagcttccaggccttggt
gtgatgttgctgccaggtgactacggcttcgaagacgcccagggtacccgcctgaacccc
agctacctgccgctgcagctgctcgaccgcttcagcgatgtggaccccttgtggggtgag
ctggcggccaacacgcggcgtttgtggttggcatcgtcgccaaagggttttgccccggac
tggttgctgtggacgccggccggaaagccagcggcagacacgaaacatggcaatgccggt
gattatgacgccattcgtgtgtacctgtgggtcggcatgttggccgagggggcggcgcaa
cgccgcgaactggtggcccattatgcgccgatggcggcattgacccagcgccaggggcta
cctcctgagcacctggatgcacgcagcggtgaagcccgcggccatggcccggcgggtttc
tctgcggccttgctgccattgcttgctgcctcgccagagcacgtggccggcttggcggcc
cagcgccagcgcttgcgcgaacagccggtcgaggccaaggcgtattacagccaggtgctg
gcgctgttcggccagggcttcgacgaggcccgttaccgttttgacccgcacggccggctg
ttgccggcctggagcgcgccatgcagcgaatga

DBGET integrated database retrieval system