KEGG   Pseudomonas putida KT2440: PP_2637Help
Entry
PP_2637           CDS       T00114                                 

Definition
endo-1,4-D-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ppu  Pseudomonas putida KT2440
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ppu00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
3018360..3019472
Genome map
AA seq 370 aa AA seqDB search
MRQMLVGLVALGLPVFANAGSVCPWPAWERFKAELVSVDGRVIDPSDERLITTSEGQSYA
LFFALVGNDRQTFAQLLRWTSNNLAEGDLARHLPAWLWGRDGQQQWQVLDANNASDADLW
IAYSLLEAGRLWDQPAYTQLGQHLLWRIAAQTVRKLPGLGVMLLPGDYGFEDAQGTRLNP
SYLPLQLLDRFSDVDPLWGELAANTRRLWLASSPKGFAPDWLLWTPAGKPAADTKHGNAG
DYDAIRVYLWVGMLAEGAAQRRELVAHYAPMAALTQRQGLPPEHLDARSGEARGHGPAGF
SAALLPLLAASPEHVAGLAAQRQRLREQPVEAKAYYSQVLALFGQGFDEARYRFDPHGRL
LPAWSAPCSE
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgcgccagatgctggtagggctggtcgccttaggcctgcccgttttcgccaatgccggg
tcggtttgcccatggcctgcctgggagcggttcaaggccgagctggtgagtgtggatggg
cgggtcatcgacccgagtgacgagcgcctgatcaccacctcggaagggcagagttacgcg
ctgttcttcgccctggtaggtaacgaccggcaaaccttcgcgcagttgctgcgttggacc
agcaacaacctcgccgagggtgacctggcccggcatctgcctgcctggctgtggggccgt
gacgggcagcagcagtggcaggtgctggacgccaacaacgccagcgatgccgatctgtgg
atcgcctacagcctgctggaagcagggcggttgtgggaccagccggcctacacgcaactg
ggccagcacctgctgtggcgtatcgccgcgcagaccgtgcgcaagcttccaggccttggt
gtgatgttgctgccaggtgactacggcttcgaagacgcccagggtacccgcctgaacccc
agctacctgccgctgcagctgctcgaccgcttcagcgatgtggaccccttgtggggtgag
ctggcggccaacacgcggcgtttgtggttggcatcgtcgccaaagggttttgccccggac
tggttgctgtggacgccggccggaaagccagcggcagacacgaaacatggcaatgccggt
gattatgacgccattcgtgtgtacctgtgggtcggcatgttggccgagggggcggcgcaa
cgccgcgaactggtggcccattatgcgccgatggcggcattgacccagcgccaggggcta
cctcctgagcacctggatgcacgcagcggtgaagcccgcggccatggcccggcgggtttc
tctgcggccttgctgccattgcttgctgcctcgccagagcacgtggccggcttggcggcc
cagcgccagcgcttgcgcgaacagccggtcgaggccaaggcgtattacagccaggtgctg
gcgctgttcggccagggcttcgacgaggcccgttaccgttttgacccgcacggccggctg
ttgccggcctggagcgcgccatgcagcgaatga

DBGET integrated database retrieval system