KEGG   Pseudomonas putida KT2440: PP_2943Help
Entry
PP_2943           CDS       T00114                                 

Definition
cytochrome c551 peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
ppu  Pseudomonas putida KT2440
Brite
Enzymes [BR:ppu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     PP_2943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3346695..3347693
Genome map
AA seq 332 aa AA seqDB search
MFAQTTCRFRSVLHPQRLRRCLSLWVLLVLSVDSGAELLDEPLKPLPPIPALAPGRVELG
RQLFNDPRLSHNGTLSCASCHRLDTYGVDGRAFSMGADGLPLALNTPTVLNASLNFRQFW
DGRVESLEEQGDAVITSAHEMGGDWRVIEQRIAADVRYRQAFEDAYPDAVTKDNILSALA
DYQRTLLTPGARFDRYLQGDTEALTLEEKYGYQRFKDYGCIACHQGVNIGGNMFQKFGVF
GDYIADRGNPTEADQGRFNVTAEEADRGVFKVPSLRNVAMTAPYFHDGSAPTLERAIDVM
FQYQLGRIPSDEDRRLIMLFLKTLTAEKAGQP
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgttcgcgcagacaacctgtcgttttcgttccgttcttcacccgcagcgcttgcgacgt
tgcctgagcctgtgggtgctactcgttctgagtgtggacagcggggccgagctgctggac
gagccgctcaagccactgcctccgattcccgctctggcacccgggcgtgtcgagctgggc
cgccagttgttcaacgatccgcggttgtcgcacaacggcacactgtcctgcgccagttgt
caccgtctggacacgtacggggtcgatggccgggcgttctccatgggtgcagatggcctg
ccacttgcgctcaatacgccaacggtactcaatgccagccttaatttccggcagttctgg
gatggccgggtcgagtcactcgaggagcagggggatgccgtgatcaccagcgctcacgag
atgggcggagactggcgcgtgatcgagcagcgcatcgccgcagacgtgcgttaccgccag
gcgttcgaggatgcctacccggacgcggtgacaaaggacaacatcctcagcgcgttggcc
gattaccaaaggacgcttcttacccctggcgcacgtttcgatcgttacctgcagggcgat
accgaggcgcttaccctggaggaaaaatacggctatcagcgcttcaaggactacggctgc
atcgcctgccaccaaggggtgaatattgggggcaacatgttccagaaatttggcgtgttc
ggcgactacatcgctgaccgcggcaaccccaccgaggcggatcagggccgcttcaacgtg
accgcagaggaggccgaccggggtgtgttcaaagtgccgagcctgcgcaatgtggcgatg
accgcgccctatttccacgatggctcggcgcctacgctggagcgtgcgatcgacgtgatg
ttccagtatcagcttggacgaatcccaagcgatgaggaccgcaggctcatcatgctgttc
ctcaaaacccttactgctgaaaaggcgggtcagccatga

DBGET integrated database retrieval system