KEGG   Pseudomonas putida KT2440: PP_3073Help
Entry
PP_3073           CDS       T00114                                 

Gene name
hbdH
Definition
(RefSeq) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
ppu  Pseudomonas putida KT2440
Pathway
ppu00072  Synthesis and degradation of ketone bodies
ppu00650  Butanoate metabolism
ppu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppu00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    PP_3073 (hbdH)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    PP_3073 (hbdH)
Enzymes [BR:ppu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     PP_3073 (hbdH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR PALP
Motif
Other DBs
NCBI-GeneID: 1043762
NCBI-ProteinID: NP_745217
UniProt: Q88IC6
Position
complement(3456518..3457288)
Genome map
AA seq 256 aa AA seqDB search
MTLEGKTALVTGSTSGIGLGIAQVLARAGANIVLNGFGDPGPAMAEIARHGVKVVHHPAD
LSDVVQIEALFNLAEREFGGVDILVNNAGIQHVAPVEQFPPESWDKIIALNLSAVFHGTR
LALPGMRTRNWGRIINIASVHGLVGSIGKAAYVAAKHGVIGLTKVVGLETATSHVTCNAI
CPGWVLTPLVQKQIDDRAAKGGDRLQAQHDLLAEKQPSLAFVTPEHLGELVLFLCSEAGS
QVRGAAWNVDGGWLAQ
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgacccttgaaggcaaaactgcactcgtcaccggttccaccagcggcattggcctgggc
atcgcccaggtattggcccgggctggcgccaacatcgtgctcaacggctttggtgacccg
ggccccgccatggcggaaattgcccggcacggggtgaaggttgtgcaccacccggccgac
ctgtcggatgtggtccagatcgaggctttgttcaacctggccgaacgcgagttcggcggc
gtcgacatcctggtcaacaacgccggtatccagcatgtggcaccggttgagcagttcccg
ccagaaagctgggacaagatcatcgccctgaacctgtcggccgtattccatggcacgcgc
ctggcgctgccgggcatgcgcacgcgcaactgggggcgcatcatcaatatcgcttcggtg
catggcctggtcggctcgattggcaaggcagcctacgtggcagccaagcatggcgtgatc
ggcctgaccaaggtggtcggcctggaaaccgccaccagtcatgtcacctgcaatgccata
tgcccgggctgggtgctgacaccgctggtgcaaaagcagatcgacgatcgtgcggccaag
ggtggcgatcggctgcaagcgcagcacgatctgctggcagaaaagcaaccgtcgctggct
ttcgtcacccccgaacacctcggtgagctggtactctttctgtgcagcgaggccggtagc
caggttcgcggcgccgcctggaacgtcgatggtggctggttggcccagtga

DBGET integrated database retrieval system