KEGG   Pseudomonas putida KT2440: PP_3284Help
Entry
PP_3284           CDS       T00114                                 

Gene name
paaF
Definition
(RefSeq) enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ppu  Pseudomonas putida KT2440
Pathway
ppu00071  Fatty acid degradation
ppu00280  Valine, leucine and isoleucine degradation
ppu00281  Geraniol degradation
ppu00310  Lysine degradation
ppu00360  Phenylalanine metabolism
ppu00362  Benzoate degradation
ppu00380  Tryptophan metabolism
ppu00410  beta-Alanine metabolism
ppu00627  Aminobenzoate degradation
ppu00640  Propanoate metabolism
ppu00650  Butanoate metabolism
ppu00903  Limonene and pinene degradation
ppu00930  Caprolactam degradation
ppu01100  Metabolic pathways
ppu01110  Biosynthesis of secondary metabolites
ppu01120  Microbial metabolism in diverse environments
ppu01130  Biosynthesis of antibiotics
ppu01212  Fatty acid metabolism
Module
ppu_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ppu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PP_3284 (paaF)
   00650 Butanoate metabolism
    PP_3284 (paaF)
  Lipid metabolism
   00071 Fatty acid degradation
    PP_3284 (paaF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PP_3284 (paaF)
   00310 Lysine degradation
    PP_3284 (paaF)
   00360 Phenylalanine metabolism
    PP_3284 (paaF)
   00380 Tryptophan metabolism
    PP_3284 (paaF)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PP_3284 (paaF)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PP_3284 (paaF)
   00281 Geraniol degradation
    PP_3284 (paaF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PP_3284 (paaF)
   00627 Aminobenzoate degradation
    PP_3284 (paaF)
   00930 Caprolactam degradation
    PP_3284 (paaF)
Enzymes [BR:ppu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PP_3284 (paaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 SDH_sah
Motif
Other DBs
NCBI-GeneID: 1046932
NCBI-ProteinID: NP_745427
UniProt: Q88HR9
Position
complement(3718627..3719400)
Genome map
AA seq 257 aa AA seqDB search
MPRYIDVQAPEHGVQLITLQRPEALNALCTELLAELAAALQAAGNDEHVRATVITGSAKA
FAAGADIREMADRDLVGILNDPRVAHWQSIAAFAKPLIAAVNGYALGGGCELAMCADIVI
ASTDARFGQPEINLGIIPGAGGTQRLLRAVGKPLAMQMVLTGEAITALRAQQAGLVSEIT
QPELTVERAMQVARSIAAKAPLAVRLAKEALLKAGDTDLASGLRFERHAFTLLAGTADRD
EGIRAFQEKRQARFQGR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgatatatcgatgtgcaggcgcccgaacatggcgttcagctcattaccctgcaa
cggcccgaggccttgaatgccctgtgcaccgagctactggcagaactggccgctgcgctg
caggctgccgggaacgacgagcatgtccgtgccacagtgattaccggcagcgccaaggca
ttcgccgcaggcgccgacatccgcgagatggccgatcgcgacctggtcggcatcctcaat
gacccgcgcgtagcgcattggcaaagcatcgccgcattcgccaaaccgctgattgctgca
gtcaacggctatgccctgggtggcggttgcgaactggcaatgtgcgccgacatcgtcatc
gccagtaccgacgcccgtttcggccagccggaaatcaaccttggcatcatccccggtgct
ggcggcacccagcgcctgttacgtgccgtcggtaagccgttggccatgcagatggtgctg
acgggggaagccatcactgccctccgcgcccagcaggccggcctggtcagcgaaatcacc
cagcccgaactcaccgtagaacgcgccatgcaggttgcccgcagcatcgccgccaaagcg
ccgctggctgtgcgcctggccaaggaggcgttactgaaggccggtgataccgacctggcc
agcggcctgcgcttcgagcgccatgccttcaccctgctggcgggcaccgccgaccgcgat
gaaggcatccgcgccttccaggaaaagcgccaggcccgcttccaagggcgctga

DBGET integrated database retrieval system