KEGG   Pseudomonas putida KT2440: PP_3506Help
Entry
PP_3506           CDS       T00114                                 

Definition
magnesium chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
ppu  Pseudomonas putida KT2440
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ppu00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(3975851..3976864)
Genome map
AA seq 337 aa AA seqDB search
MSEPVQFPLAAVVGADDLKLALCLTAIDPRIGGVLIEGPRGMAKSTLARGLADLLGEGPF
VTLPLGASEERLVGTLDLDAALGQGKAQFSPGVLAQADGGVLYVDEVNLLPDTLVDLLLD
VAASGTNRIERDGISHRHSARFVLIGTMNPEEGELRPQLLDRFGLNVALEGLPEPEARQQ
IIRRRLAFDNDPQAFCAHWAQAQAQLRERCHAARQALADIALDDQALAWITERCYAAGVD
GLRADLVWLRAARAHCAWRGAAAIEEVDVEAVAEFALRHRRRMTPQASPPSAPQPPDQQP
GAGNPGERGGQGDWGALPAQPVASGARREVPNWAKKP
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacccgtacaatttccgctggcggccgtggtcggtgcagacgacctcaagctg
gcgctgtgcctgaccgctatcgaccccaggatcggtggtgtgttgatcgaagggccgcgt
ggcatggccaagagcaccctggcccgtggcctggccgacctgcttggcgaaggcccgttc
gtcaccttgccattgggcgccagtgaagagcggctggtcggcaccctcgacctggatgcc
gcgctggggcagggcaaggcgcagttttccccgggcgtgctggcccaggccgacggcggt
gtgctgtatgtcgatgaggtcaacctgctgcccgacaccttggtcgatctgttgcttgac
gtggctgccagcggcacaaaccgcatcgagcgtgacggtatctcgcaccggcacagcgcc
cgcttcgtactgatcggcaccatgaacccggaagagggcgaactgcgcccgcagttgctc
gaccgtttcggcttgaacgtggcgctggagggcttgccggagcccgaggcccggcagcag
atcattcgccgccgtctggccttcgacaatgaccctcaggcgttctgcgcacactgggcc
caggcccaggcgcaactgcgcgagcgctgccacgcggcgcgccaggccttggccgacatt
gccctggatgaccaggcgcttgcctggattaccgagcgctgctacgccgccggcgtggac
ggcctgcgcgccgacctggtgtggctgcgcgctgcgcgcgcccactgtgcctggcgtggg
gctgcagctatcgaagaagtggatgtcgaggcggtggccgaattcgccctgcgccatcgc
cgccgtatgacgccccaggccagcccgccgtcggcgccacagccgcctgaccagcagcct
ggcgccggcaacccgggtgagcggggcgggcagggcgactggggggcattaccggcacag
ccggtagccagcggcgcccgccgcgaggtgccgaactgggcaaaaaagccctga

DBGET integrated database retrieval system