KEGG   Pseudomonas putida KT2440: PP_3754Help
Entry
PP_3754           CDS       T00114                                 

Gene name
bktB
Definition
(RefSeq) beta-ketothiolase BktB
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ppu  Pseudomonas putida KT2440
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:ppu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PP_3754 (bktB)
   00630 Glyoxylate and dicarboxylate metabolism
    PP_3754 (bktB)
   00640 Propanoate metabolism
    PP_3754 (bktB)
   00650 Butanoate metabolism
    PP_3754 (bktB)
  Lipid metabolism
   00071 Fatty acid degradation
    PP_3754 (bktB)
   00072 Synthesis and degradation of ketone bodies
    PP_3754 (bktB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PP_3754 (bktB)
   00310 Lysine degradation
    PP_3754 (bktB)
   00380 Tryptophan metabolism
    PP_3754 (bktB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PP_3754 (bktB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PP_3754 (bktB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PP_3754 (bktB)
Enzymes [BR:ppu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PP_3754 (bktB)
Exosome [BR:ppu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PP_3754 (bktB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
4283398..4284582
Genome map
AA seq 394 aa AA seqDB search
MSSAEIYVVSAVRSAIGGFGGSLKDLPLADLASAVTRAAIERSGLAAEQVGHMVMGTVIP
TEPRDAYLARVAAMNAGIPKETPAFNVNRLCGSGLQAIVSAAQGLLLGDTDVAVAAGAES
MSRGPYLLPQARWGARMGDLQGIDYTVGVLQDPFQHFHMGITAENVSAKYGITREMQDEL
ALTSQRRAARAIAEGRFASQIVALELKTRKGSVQFSVDEHVRADVTAEQLAGMKPVFKKD
GTVTAGNASGINDGAAGLVLATGDAVRRLGLKPLARLVGYAHAGVEPELMGLGPIPATRK
VLEKTGLNLQDLDVIESNEAFAAQACAVARELGFDPEKVNPNGSGISLGHPVGATGAIIA
TKAIHELQRIQGRYALATMCIGGGQGIAVVFERV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcgcagaaatctacgtcgtcagtgccgtccgttcagccattggtggctttggc
ggttccctcaaggacctgccgctggccgacctggccagcgccgtgacccgcgccgccatc
gagcgttcgggcctggccgccgagcaagtcggccacatggtgatgggcacggtaatcccc
accgaaccgcgtgacgcctacctggcacgggtagcggcaatgaacgctggcatccccaag
gaaacgccggcattcaacgtcaaccgcctgtgcgggtctggcctgcaggctattgtctct
gcggcccagggcctgttgctgggcgacaccgatgtggccgtcgcggccggcgccgagtcc
atgagccgtggcccttacctgctgccacaggcgcgctggggtgcacgcatgggtgacctg
caaggcatcgactataccgtcggcgtgctgcaggacccgttccagcacttccacatgggc
atcactgccgagaacgtttcggccaagtacggcattacccgcgaaatgcaggacgaactg
gcactgaccagccagcgccgcgccgctcgtgcgattgccgagggccgcttcgccagccag
atcgttgcgctggagctgaaaacccgcaagggcagcgtgcagttcagtgtcgacgagcat
gtgcgcgctgatgtgaccgccgaacaactggccggcatgaagccggtgttcaagaaagac
ggcaccgtcactgccggcaacgccagcggtatcaacgatggcgccgccggcctggtgttg
gccaccggtgacgcggtgcgccgcctgggcctgaagccactggcacgcctggtgggctat
gcccatgccggggtggaacctgagctgatgggccttgggccgatcccggccacccgcaaa
gtgctggaaaaaaccggcctgaacctgcaagacctggatgtgatcgagtccaacgaagcc
ttcgctgcccaggcctgcgccgttgcccgcgagctgggcttcgacccggaaaaggtcaac
cccaacggttcgggcatttccctgggccacccggtgggtgccaccggtgcgatcatcgcc
accaaggccatccatgagctgcagcgcatccagggccgctacgccctggccacgatgtgt
atcggcggtggccaaggcatcgccgtcgtgttcgagcgcgtctga

DBGET integrated database retrieval system