KEGG   Pseudomonas putida KT2440: PP_3759Help
Entry
PP_3759           CDS       T00114                                 

Definition
chemotaxis protein CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ppu  Pseudomonas putida KT2440
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ppu00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PP_3759
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    PP_3759
Enzymes [BR:ppu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     PP_3759
Two-component system [BR:ppu02022]
 CheA family
  CheA-CheYBV
   PP_3759
Bacterial motility proteins [BR:ppu02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    PP_3759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(4287727..4288302)
Genome map
AA seq 191 aa AA seqDB search
MSGVRAVVIGASAGGVAALFQVLGTLPSAFAIPVLCVLHLPDDRHSQLAGVLQRRLHRPV
CEARDKESISSGQIYVAGPGYHLSVERDLTLSLSQEEPVHFSRPAIDFLFISAADAYGDG
LLGVLLTGANEDGARGLAYIKNNGGRTIVQDPRDAQVALMPEAALALHQPDHILTLSGIG
QLLATLEYSAC
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgtacgcgcagtggtgatcggcgcctcggccggtggcgtggcggcattgttc
caggtgctcggcacgctgccatcggcgttcgccataccggtgctctgcgtgctgcacctg
ccggacgaccgccacagccaactggctggcgtgctgcagcggcggctgcatcggccggta
tgcgaggcacgcgacaaggagagcatcagcagcgggcagatctatgtggcggggccgggt
taccacttgtcggtggagcgcgacctgacgctgtcgctgagccaggaagaacccgtgcac
ttctcgcgcccggcgatcgatttcctgttcatctcggcggccgatgcctatggcgatggc
ctgctgggtgtgctgctcaccggggccaacgaagacggcgccaggggccttgcctacatc
aagaacaatggggggcgcacgatcgtccaggaccctcgtgacgcacaggttgccctgatg
ccggaggccgccctggccctgcaccagcccgaccatatccttactctgagcggtatcggg
cagttgctcgcgaccctggaatacagcgcatgctaa

DBGET integrated database retrieval system