KEGG   Pseudomonas putida KT2440: PP_3821Help
Entry
PP_3821           CDS       T00114                                 

Gene name
galU
Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ppu  Pseudomonas putida KT2440
Pathway
ppu00040  Pentose and glucuronate interconversions
ppu00052  Galactose metabolism
ppu00500  Starch and sucrose metabolism
ppu00520  Amino sugar and nucleotide sugar metabolism
ppu01100  Metabolic pathways
ppu01130  Biosynthesis of antibiotics
Module
ppu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ppu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PP_3821 (galU)
   00052 Galactose metabolism
    PP_3821 (galU)
   00500 Starch and sucrose metabolism
    PP_3821 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    PP_3821 (galU)
Enzymes [BR:ppu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PP_3821 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-GeneID: 1046744
NCBI-ProteinID: NP_745951
UniProt: Q88GA4
Position
complement(4349109..4349948)
Genome map
AA seq 279 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALDAGLNEISIVTGRGKR
ALEDHFDISYELENQIKGTDKEKYLVGIRRLLNECSFSYTRQTEMKGLGHAILTGRPLIG
DEPFAVVLADDLCVNPEGDGVLTQMVKLYKQYRCSIVAIQEVDPQETNKYGVIAGEMIRD
DIFRVTNMVEKPAPEDAPSNLAIIGRYILTPDIFDIIANTKPGKGGEIQITDALLQQAKD
GCVIAYKFKGKRFDCGGAEGYIDATNFCFENYYKTGKAY
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaaatgcttgttcccggcagccggctacggcacgcgcttcttgcctgctacc
aaagccatgcccaaggaaatgctgccggtggtcaacaagccactgatccagtatggcgtt
gaagaagcattggatgcgggtctgaacgagatctccatcgttaccgggcgcggcaagcgc
gccctggaagaccacttcgacatcagctacgagctggaaaaccagatcaagggcaccgac
aaggaaaaatacctggtcggtattcgtcgtctgctcaacgagtgctcgttctcgtacacg
cgccagaccgaaatgaagggcctcggccacgccattctcactggccgcccactgatcggt
gacgagccgttcgcggtggtgctggcggacgacctgtgcgtcaacccggaaggtgacggc
gtgctgactcagatggtcaagctgtacaaacagtaccgctgctcgatcgtcgccatccag
gaagtcgacccgcaggaaaccaacaagtatggtgtgatcgccggtgagatgatccgcgac
gacatcttccgtgtgaccaacatggtcgaaaaaccggccccggaagacgcgccttcgaac
ctggcgatcatcggccgttacatcctgaccccggatatcttcgacatcatcgccaacacc
aagccaggcaaaggcggtgaaatacagatcaccgacgccctgctgcagcaggcgaaggat
ggctgcgtgattgcctataagttcaagggcaagcgtttcgactgcggtggcgccgaaggc
tacatcgacgcgaccaacttctgcttcgagaactactacaagactggcaaggcttactga

DBGET integrated database retrieval system