KEGG   Pseudomonas putida KT2440: PP_3839Help
Entry
PP_3839           CDS       T00114                                 

Gene name
adhP
Definition
(RefSeq) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ppu  Pseudomonas putida KT2440
Pathway
ppu00010  Glycolysis / Gluconeogenesis
ppu00071  Fatty acid degradation
ppu00350  Tyrosine metabolism
ppu00625  Chloroalkane and chloroalkene degradation
ppu00626  Naphthalene degradation
ppu01100  Metabolic pathways
ppu01110  Biosynthesis of secondary metabolites
ppu01120  Microbial metabolism in diverse environments
ppu01130  Biosynthesis of antibiotics
ppu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ppu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PP_3839 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    PP_3839 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    PP_3839 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PP_3839 (adhP)
   00626 Naphthalene degradation
    PP_3839 (adhP)
Enzymes [BR:ppu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PP_3839 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Methyltransf_25 AlaDh_PNT_C 2-Hacid_dh_C CoA_binding TrkA_N Methyltransf_31 Imm48
Motif
Other DBs
NCBI-GeneID: 1046726
NCBI-ProteinID: NP_745969
UniProt: Q88G86
Position
4362915..4363925
Genome map
AA seq 336 aa AA seqDB search
MKAAVVAPGRRVDVIEKSLRPLEHGEALLKMQCCGVCHTDLHVKNGDFGDKTGVVLGHEG
IGVVQEVGPGVTSLKPGDRASVAWFYQGCGHCEYCNSGNETLCRDVKNSGYTVDGGMAEA
CIVKADYSVKVPDGLDSAAASSITCAGVTTYKAVKISNVRPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNEEQLRFASEMGADLVVNPLNEDAAKVIQAKTGGAHAAVVTAVAKG
AFNSAVDALRAGGRLVAVGLPSESMDLNIPRLVLDGIEVVGSLVGTRQDLQEAFQFAAEG
KVVPKVTLRPIEDINQIFDEMLEGKIKGRMVIQFEG
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgtcgttgcaccaggccgtcgcgtggacgtgatagagaaaagcctgcgc
cctctcgaacacggcgaagcgctgctgaagatgcagtgctgcggtgtgtgccacaccgac
ctgcacgtcaaaaatggcgactttggtgacaagaccggggtagtactgggccacgaaggt
attggcgtggttcaggaagttggcccgggcgtcacctcgctcaagccaggcgaccgagcc
agcgttgcctggttctaccagggttgcggacattgcgaatactgcaacagcggcaacgag
accctgtgccgcgacgtgaagaattccggttacaccgtggacggcggcatggccgaggcc
tgcatcgtcaaggccgactactcggttaaagtgcccgacggcctcgactccgccgccgcc
agcagcatcacctgcgccggcgtcacgacctacaaggcagtgaaaatctccaacgtccgc
cccggccaatggatcgccatctacgggctcggcggcctgggcaacctggccctgcaatat
gccaagaatgtgttcaacgccaaagtcatcgccatcgacgtcaacgaagagcaactgcgc
ttcgccagcgagatgggcgcggatctggtcgtcaacccgctcaacgaagatgccgcgaag
gtcatccaggccaaaaccggcggtgcacatgctgccgtcgttactgctgtggccaaaggc
gcgttcaactcggctgtcgatgccttgcgcgctggcgggcgactggtggccgtcgggctt
ccgtcggagtccatggacctgaatattccccgcctggtgcttgatgggatcgaagtggtg
ggctcgctggtaggtacacgccaggacctgcaggaagccttccagtttgccgctgaaggc
aaagtggtgcccaaggtaacgctgcgaccgatcgaggatatcaaccagatctttgacgag
atgctggagggcaagatcaaaggccggatggtgatacagttcgaaggctga

DBGET integrated database retrieval system