KEGG   Pseudomonas putida KT2440: PP_3839Help
Entry
PP_3839           CDS       T00114                                 

Gene name
adhA, adhP
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ppu  Pseudomonas putida KT2440
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ppu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    PP_3839 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PP_3839 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    PP_3839 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    PP_3839 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PP_3839 (adhA)
   00626 Naphthalene degradation
    PP_3839 (adhA)
Enzymes [BR:ppu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PP_3839 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
4362913..4363923
Genome map
AA seq 336 aa AA seqDB search
MKAAVVAPGRRVDVIEKSLRPLEHGEALLKMQCCGVCHTDLHVKNGDFGDKTGVVLGHEG
IGVVQEVGPGVTSLKPGDRASVAWFYQGCGHCEYCNSGNETLCRDVKNSGYTVDGGMAEA
CIVKADYSVKVPDGLDSAAASSITCAGVTTYKAVKISNVRPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNEEQLRFASEMGADLVVNPLNEDAAKVIQAKTGGAHAAVVTAVAKG
AFNSAVDALRAGGRLVAVGLPSESMDLNIPRLVLDGIEVVGSLVGTRQDLQEAFQFAAEG
KVVPKVTLRPIEDINQIFDEMLEGKIKGRMVIQFEG
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgtcgttgcaccaggccgtcgcgtggacgtgatagagaaaagcctgcgc
cctctcgaacacggcgaagcgctgctgaagatgcagtgctgcggtgtgtgccacaccgac
ctgcacgtcaaaaatggcgactttggtgacaagaccggggtagtactgggccacgaaggt
attggcgtggttcaggaagttggcccgggcgtcacctcgctcaagccaggcgaccgagcc
agcgttgcctggttctaccagggttgcggacattgcgaatactgcaacagcggcaacgag
accctgtgccgcgacgtgaagaattccggttacaccgtggacggcggcatggccgaggcc
tgcatcgtcaaggccgactactcggttaaagtgcccgacggcctcgactccgccgccgcc
agcagcatcacctgcgccggcgtcacgacctacaaggcagtgaaaatctccaacgtccgc
cccggccaatggatcgccatctacgggctcggcggcctgggcaacctggccctgcaatat
gccaagaatgtgttcaacgccaaagtcatcgccatcgacgtcaacgaagagcaactgcgc
ttcgccagcgagatgggcgcggatctggtcgtcaacccgctcaacgaagatgccgcgaag
gtcatccaggccaaaaccggcggtgcacatgctgccgtcgttactgctgtggccaaaggc
gcgttcaactcggctgtcgatgccttgcgcgctggcgggcgactggtggccgtcgggctt
ccgtcggagtccatggacctgaatattccccgcctggtgcttgatgggatcgaagtggtg
ggctcgctggtaggtacacgccaggacctgcaggaagccttccagtttgccgctgaaggc
aaagtggtgcccaaggtaacgctgcgaccgatcgaggatatcaaccagatctttgacgag
atgctggagggcaagatcaaaggccggatggtgatacagttcgaaggctga

DBGET integrated database retrieval system