KEGG   Pseudomonas putida KT2440: PP_4052Help
Entry
PP_4052           CDS       T00114                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ppu  Pseudomonas putida KT2440
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PP_4052 (malQ)
Enzymes [BR:ppu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     PP_4052 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
4568068..4570137
Genome map
AA seq 689 aa AA seqDB search
MSETALHRLASSVGLSRDWIDANARPQRVSDDVLRNILEGLGHPAGDDAAVAASLRAVET
AEDSEHLPPLLTADVGQPLALSRYFSAASVAHCTLEDHTSVTLSLDDQARLPGELPIGYH
QVEIDSRRFTVAVAPTRCHSLEEKVQQPPPRCWGLAVQLYSLRRPGDGGFGDCLALEQLA
RSAAERGADALAISPIHALSAIDQEHYSPYSPSSRLLLNTLYTSPAALLGEREVRMAIEA
CGLEQQLEELEQRPLVDWPRAASARLRLLEALYQGFSHGDHPLRTDFDSFREAGGQTLEH
HCRFEVLQAQAVEHGLGADWRNWPKAWHDPYHPEVEALANAYPAKVEFRAFCQWLTERGL
QRAHEAARSNGMAVGLIADLAVGADGAGSQAWSRQDELLAGLSVGAPPDILNHVGQDWGI
CAFSPDGLKRNGYRAFIEMLRANLAHAGGLRIDHVMGLRRLWLIPQGAKPSEGAYLDYPL
DDLLRLLALESVRHQAIILGEDLGTVPDSLREKLAEKAVLGMRVLPFEQTQPGQFKPILD
WPDNALATTGTHDLAPLAGWLANRDIDWRHRLQLIDAATELHWRHERQKEREGLRRILEA
NYGELKDNDALIDAAIRFVGHTRAPLVLVPLEDLLGCDEQPNLPGTTNGHPNWRRRFSRP
VRELLDDEDAARRLELLAQAREQAWERDR
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaaccgccctgcaccgtctggcatccagcgtcgggctgagccgcgactggatc
gacgccaatgccaggccccagcgtgtcagcgacgacgtgctgcgcaacatcctcgaaggc
cttggccacccggccggcgatgacgcggccgttgccgccagcctgcgtgcggtggaaacc
gccgaagacagcgaacacctgccgcccttgctgaccgccgacgtaggccagccgttagcg
ctgtcgcgctacttcagtgccgccagcgtggcccactgcaccctggaagatcacacctct
gtcaccctcagcctcgatgaccaggcgcgcctgcccggcgagctgcccatcggctatcac
caggtggaaatcgacagccgccgcttcaccgtggcagtggcgccaacacgctgtcacagc
ctggaagaaaaggtgcaacagccgccaccacgctgctggggcctggcagtgcagctgtac
agcctgcgccgccccggcgatgggggcttcggcgactgcctggcgctggagcagttggcc
cgctcggccgccgagcgcggcgccgatgccttggctatcagcccgattcacgccctgtcg
gccatcgaccaggaacactacagcccctactcaccttccagtcgcctgctgctcaacacc
ctgtataccagccccgcggccctgctgggtgaacgggaagtgcgcatggccatcgaagcc
tgcgggctggagcaacaactcgaagagctggagcagcgccctctggtcgactggccacgc
gccgccagcgcccggctgcgtttgcttgaagcgctttaccaaggcttcagccacggcgac
cacccgctacgcacagattttgacagcttccgcgaagccggcggccagaccctggagcac
cactgccgcttcgaggttctgcaggcccaggcggtggagcacggcctcggggccgactgg
cgcaactggcccaaagcctggcatgacccctaccacccggaagtggaggctttagccaat
gcctacccggccaaggtcgagttccgcgccttctgccagtggctgactgaacgtggcctg
caacgtgcccacgaagcggcccgcagcaacggcatggccgtgggcctgatcgccgacctg
gcggtgggcgccgatggtgccggcagccaggcctggagccgccaggacgaactgctggcc
ggcctgagcgtgggtgcgccgcccgacatcctcaaccacgtagggcaggattggggcatt
tgcgccttctcgcccgacggcctcaagcgcaatggctatcgcgccttcatcgagatgctg
cgggccaacctcgcccacgctggcggcctgcgcatcgaccatgtgatgggcctgcgccgg
ctatggctgatcccgcagggggccaaacccagcgagggcgcctacctcgactacccgcta
gacgacctgttgcgcctgctggcgctggagtcggtgcgtcaccaggcgatcatcctgggt
gaagacctgggcaccgtgcccgacagcctgcgcgaaaagctggccgagaaagcggtgctg
ggcatgcgcgtgctgccgttcgagcagacccagccgggccagttcaagcccattctcgac
tggccggacaatgccctggccacaaccggcacccacgacctggcgccactggccggctgg
ctggcaaaccgcgacatcgactggagacaccgtttgcaactgatcgacgccgctaccgaa
ttgcactggcgacacgagcgtcagaaagaacgcgaaggcctgcgccgcatcctggaggcc
aactacggcgaactgaaggacaacgacgcgctgatcgatgcggccatccgcttcgttggc
catacccgtgcgccgctggtgctggtaccgctggaagacctgctgggctgcgacgagcaa
cccaacctgccgggcaccaccaatggccatcccaactggcggcggcgcttttcccgccca
gtacgcgaactactcgacgacgaggatgccgcacggcgcctggagctgctggcccaggcc
cgcgaacaggcgtgggagcgtgaccgatga

DBGET integrated database retrieval system