KEGG   Pseudomonas putida KT2440: PP_4116Help
Entry
PP_4116           CDS       T00114                                 

Gene name
aceA
Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ppu  Pseudomonas putida KT2440
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:ppu01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:ppu00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
4653520..4654845
Genome map
AA seq 441 aa AA seqDB search
MALTREQQIAALEKDWAENPRWKGVTRTYTAADVVRLRGSVQPEHTFARQGAEKLWKLVT
EGAHPSFRPDKDFVNCMGALTGGQAVQQVKAGIQAIYLSGWQVAADNNSAESMYPDQSLY
PVDSVPTVVKRINNAFRRADQIQWKAGKNPGDDGYIDYFAPIVADAEAGFGGVLNAYELM
KNMIEAGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLVAARLAADVSGVPTIILAR
TDANAADLLTSDCDPYDQPFVVGERTREGFYKVRAGLDQAIARGLAYAPYADLIWCETAK
PDLDEARRFAEAIKKEYPDQILSYNCSPSFNWKKNLDDATIAKFQRELSAMGYKHQFITL
AGIHNMWHGMFNLAHDYARNDMTAYVKLQEQEFADASKGYTFVAHQQEVGTGYFDDMTTV
IQGGASSVTALTGSTEEEQFH
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggcactgacacgcgaacagcaaattgcagccctcgagaaagactgggccgaaaacccg
cgctggaaaggcgtgacccgtacctacaccgccgctgatgtcgttcgcctgcgtggctcc
gtgcaacctgagcacacctttgcgcgtcagggcgcagaaaaactgtggaagctggtcacc
gaaggtgcccacccgtccttccgccccgacaaagatttcgtcaactgcatgggcgccctg
accggcggccaggctgtacaacaggtcaaggccggcatccaggccatctacctgtccggc
tggcaggttgccgccgacaacaactcggccgagtcgatgtaccctgaccagtcgctgtac
ccggtcgactcggtaccgaccgtggtcaaacgcatcaacaacgcgttccgccgcgccgac
cagatccagtggaaagccggcaagaacccgggcgacgacggctacatcgactacttcgcg
ccgatcgtggccgacgccgaagccggtttcggtggcgtactgaacgcctacgagctgatg
aagaacatgatcgaagcaggcgccgccggcgtgcacttcgaagaccagctggcctcggtg
aaaaaatgcggccacatgggcggcaaggtgctggtgccgactcaggaagccgtgcagaag
ctggtggccgctcgcctggccgctgacgtgtcgggtgtaccgaccatcatcctggcgcgt
accgatgccaacgccgccgacctgctgaccagcgactgcgacccgtacgaccagccgttc
gtggttggcgagcgcacccgcgaaggcttctacaaggtccgcgccggcctcgaccaggcc
attgcccgcggcctggcctacgccccgtacgccgacctgatctggtgcgaaaccgccaag
ccggacctggacgaagcccgtcgcttcgccgaggcgatcaagaaggagtacccggaccag
atcctgtcgtacaactgctcgccttccttcaactggaagaaaaacctggacgacgccacc
atcgccaagttccagcgcgaactgtcggccatgggttacaagcatcagttcatcaccctg
gccggcatccacaacatgtggcacggcatgttcaacctggcgcacgactacgcccgcaac
gacatgaccgcctacgtgaagctgcaggagcaggaattcgctgacgccagcaagggctac
accttcgtggcgcaccagcaggaagtgggcactggctacttcgacgacatgaccaccgtg
atccagggcggcgcttcgtcggtgactgcactgaccggttcgaccgaagaagagcagttc
cactga

DBGET integrated database retrieval system