KEGG   Pseudomonas putida KT2440: PP_4116Help
Entry
PP_4116           CDS       T00114                                 

Gene name
aceA
Definition
(RefSeq) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
ppu  Pseudomonas putida KT2440
Pathway
ppu00630  Glyoxylate and dicarboxylate metabolism
ppu01100  Metabolic pathways
ppu01110  Biosynthesis of secondary metabolites
ppu01120  Microbial metabolism in diverse environments
ppu01200  Carbon metabolism
Module
ppu_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ppu00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PP_4116 (aceA)
Enzymes [BR:ppu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     PP_4116 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-GeneID: 1042253
NCBI-ProteinID: NP_746235
UniProt: Q88FI0
Position
4653523..4654848
Genome map
AA seq 441 aa AA seqDB search
MALTREQQIAALEKDWAENPRWKGVTRTYTAADVVRLRGSVQPEHTFARQGAEKLWKLVT
EGAHPSFRPDKDFVNCMGALTGGQAVQQVKAGIQAIYLSGWQVAADNNSAESMYPDQSLY
PVDSVPTVVKRINNAFRRADQIQWKAGKNPGDDGYIDYFAPIVADAEAGFGGVLNAYELM
KNMIEAGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLVAARLAADVSGVPTIILAR
TDANAADLLTSDCDPYDQPFVVGERTREGFYKVRAGLDQAIARGLAYAPYADLIWCETAK
PDLDEARRFAEAIKKEYPDQILSYNCSPSFNWKKNLDDATIAKFQRELSAMGYKHQFITL
AGIHNMWHGMFNLAHDYARNDMTAYVKLQEQEFADASKGYTFVAHQQEVGTGYFDDMTTV
IQGGASSVTALTGSTEEEQFH
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggcactgacacgcgaacagcaaattgcagccctcgagaaagactgggccgaaaacccg
cgctggaaaggcgtgacccgtacctacaccgccgctgatgtcgttcgcctgcgtggctcc
gtgcaacctgagcacacctttgcgcgtcagggcgcagaaaaactgtggaagctggtcacc
gaaggtgcccacccgtccttccgccccgacaaagatttcgtcaactgcatgggcgccctg
accggcggccaggctgtacaacaggtcaaggccggcatccaggccatctacctgtccggc
tggcaggttgccgccgacaacaactcggccgagtcgatgtaccctgaccagtcgctgtac
ccggtcgactcggtaccgaccgtggtcaaacgcatcaacaacgcgttccgccgcgccgac
cagatccagtggaaagccggcaagaacccgggcgacgacggctacatcgactacttcgcg
ccgatcgtggccgacgccgaagccggtttcggtggcgtactgaacgcctacgagctgatg
aagaacatgatcgaagcaggcgccgccggcgtgcacttcgaagaccagctggcctcggtg
aaaaaatgcggccacatgggcggcaaggtgctggtgccgactcaggaagccgtgcagaag
ctggtggccgctcgcctggccgctgacgtgtcgggtgtaccgaccatcatcctggcgcgt
accgatgccaacgccgccgacctgctgaccagcgactgcgacccgtacgaccagccgttc
gtggttggcgagcgcacccgcgaaggcttctacaaggtccgcgccggcctcgaccaggcc
attgcccgcggcctggcctacgccccgtacgccgacctgatctggtgcgaaaccgccaag
ccggacctggacgaagcccgtcgcttcgccgaggcgatcaagaaggagtacccggaccag
atcctgtcgtacaactgctcgccttccttcaactggaagaaaaacctggacgacgccacc
atcgccaagttccagcgcgaactgtcggccatgggttacaagcatcagttcatcaccctg
gccggcatccacaacatgtggcacggcatgttcaacctggcgcacgactacgcccgcaac
gacatgaccgcctacgtgaagctgcaggagcaggaattcgctgacgccagcaagggctac
accttcgtggcgcaccagcaggaagtgggcactggctacttcgacgacatgaccaccgtg
atccagggcggcgcttcgtcggtgactgcactgaccggttcgaccgaagaagagcagttc
cactga

DBGET integrated database retrieval system