KEGG   Pseudomonas putida KT2440: PP_4192Help
Entry
PP_4192           CDS       T00114                                 

Gene name
sdhD
Definition
(RefSeq) succinate dehydrogenase hydrophobic membrane anchor subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ppu  Pseudomonas putida KT2440
Pathway
ppu00020  Citrate cycle (TCA cycle)
ppu00190  Oxidative phosphorylation
ppu00650  Butanoate metabolism
ppu01100  Metabolic pathways
ppu01110  Biosynthesis of secondary metabolites
ppu01120  Microbial metabolism in diverse environments
ppu01130  Biosynthesis of antibiotics
ppu01200  Carbon metabolism
Module
ppu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ppu_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ppu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PP_4192 (sdhD)
   00650 Butanoate metabolism
    PP_4192 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    PP_4192 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-GeneID: 1042613
NCBI-ProteinID: NP_746309
UniProt: Q88FA6
Position
complement(4738373..4738741)
Genome map
AA seq 122 aa AA seqDB search
MVTNVTNLSRSGLYDWMAQRVSAVVLAAYFLFLIGYVVAHPGIDYTQWHGLFSNNAMRIF
SLLALVALGAHAWVGMWTIATDYLTPMSFGKSATAIRFLFQAVCGVAMFAYFVWGVQILW
GI
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaatgtcacgaacctgtcgcgttcgggcctctatgactggatggcgcagcgc
gtttctgcggtcgttctcgcggcttacttcctcttcctgatcggctacgtggtcgcccac
ccaggcatcgactacacccagtggcatggtctgttctccaacaacgcgatgcggatcttc
agtctgctggccctcgttgccctgggcgctcacgcctgggtcggcatgtggaccattgca
accgactacctgacgcctatgtcgttcggcaagtcggcaactgcgattcgtttcctgttc
caggcggtatgcggcgttgcgatgttcgcttacttcgtctggggtgtgcagattctctgg
ggtatctga

DBGET integrated database retrieval system