KEGG   Pseudomonas putida KT2440: PP_4337Help
Entry
PP_4337           CDS       T00114                                 

Gene name
cheB
Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ppu  Pseudomonas putida KT2440
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:ppu02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:ppu02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(4926768..4927880)
Genome map
AA seq 370 aa AA seqDB search
MAVKVLVVDDSGFFRRRVSEILSADPTIQVVGTATNGKEAIDQALALKPDVITMDYEMPM
MDGITAVRHIMQRCPTPVLMFSSLTHEGARVTLDALDAGAVDYLPKNFEDISRNPDKVKQ
LLCEKVHTISRSNRRIGSYARTAPVAAPAPASTFTSQAQTRPAAPARAAAPTPAASQSPA
PKRKPYKLVAIGTSTGGPVALQRVLTQLPANFPAPIVLIQHMPAAFTKAFAERLDKLCRI
SVKEAEDGDMLRPGLALLAPGGKQMMIDGRGTVKILPGDERLNYKPCVDITFGSAAKSYG
DKVLSVVLTGMGADGREGARLLKQGGSTVWAQDEASCVIYGMPMAIVKANLADAVYSLDE
IGKHLVEACV
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcaaggtcctggtggtggatgattctggtttcttccgccgccgtgtctcggaa
atcctctcggcggatccaacgatccaggtagtgggtaccgcgaccaacggcaaggaagca
atcgaccaggcgctggcgctcaagcccgatgtgatcaccatggactacgaaatgcccatg
atggatggcattaccgccgtgcggcacatcatgcagcgctgcccgacgcccgtgttgatg
ttctcgtcgctgacccatgaaggcgcccgcgtcaccctcgacgcgctggatgccggcgca
gtggactacctgccgaaaaacttcgaggacatctcgcgcaaccctgacaaggtcaagcag
ttgctgtgcgagaaggtgcacaccatttcgcgcagcaaccgccggatcggcagctatgcc
agaacggcgccggtcgccgcgccagcgccggccagcacctttaccagccaggcgcagacg
cgcccggcagcgcctgcccgtgcagcggccccgacgccggcggcctcgcagtcgccggca
cccaagcgcaaaccctacaaactggtggccatcggtacctccacgggggggccggtggcg
ctgcagcgggtactgacgcagctgccggccaatttcccggcgccgatcgtgttgatccag
cacatgccggcggccttcaccaaagcgtttgccgaacgcctggacaagctgtgccgcatc
agcgtcaaggaagccgaagacggcgacatgctgcgcccgggcctggccctgctggccccc
ggtggcaagcagatgatgatcgatggccgtggcacggtgaagatcctgcccggcgacgag
cgcctgaactacaagccgtgcgtggacatcaccttcggttcggcggccaagtcgtacggt
gacaaggtgttgtcggtggtgctcaccggcatgggcgccgatggccgcgagggcgcgcgc
ctgctcaagcaggggggcagcacggtgtgggcccaggatgaagccagctgcgtgatttat
ggcatgcccatggccatcgtcaaggcgaacctggcggatgccgtgtacagcctcgacgaa
atcggcaagcacctggtggaggcgtgcgtctga

DBGET integrated database retrieval system