KEGG   Pseudomonas putida KT2440: PP_4337Help
Entry
PP_4337           CDS       T00114                                 

Gene name
cheBA
Definition
(RefSeq) chemotaxis response regulator protein-glutamate methylesterase
  KO
K03412  
two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
ppu  Pseudomonas putida KT2440
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ppu00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PP_4337 (cheBA)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    PP_4337 (cheBA)
Enzymes [BR:ppu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     PP_4337 (cheBA)
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     PP_4337 (cheBA)
Two-component system [BR:ppu02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   PP_4337 (cheBA)
Bacterial motility proteins [BR:ppu02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    PP_4337 (cheBA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(4926769..4927881)
Genome map
AA seq 370 aa AA seqDB search
MAVKVLVVDDSGFFRRRVSEILSADPTIQVVGTATNGKEAIDQALALKPDVITMDYEMPM
MDGITAVRHIMQRCPTPVLMFSSLTHEGARVTLDALDAGAVDYLPKNFEDISRNPDKVKQ
LLCEKVHTISRSNRRIGSYARTAPVAAPAPASTFTSQAQTRPAAPARAAAPTPAASQSPA
PKRKPYKLVAIGTSTGGPVALQRVLTQLPANFPAPIVLIQHMPAAFTKAFAERLDKLCRI
SVKEAEDGDMLRPGLALLAPGGKQMMIDGRGTVKILPGDERLNYKPCVDITFGSAAKSYG
DKVLSVVLTGMGADGREGARLLKQGGSTVWAQDEASCVIYGMPMAIVKANLADAVYSLDE
IGKHLVEACV
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcaaggtcctggtggtggatgattctggtttcttccgccgccgtgtctcggaa
atcctctcggcggatccaacgatccaggtagtgggtaccgcgaccaacggcaaggaagca
atcgaccaggcgctggcgctcaagcccgatgtgatcaccatggactacgaaatgcccatg
atggatggcattaccgccgtgcggcacatcatgcagcgctgcccgacgcccgtgttgatg
ttctcgtcgctgacccatgaaggcgcccgcgtcaccctcgacgcgctggatgccggcgca
gtggactacctgccgaaaaacttcgaggacatctcgcgcaaccctgacaaggtcaagcag
ttgctgtgcgagaaggtgcacaccatttcgcgcagcaaccgccggatcggcagctatgcc
agaacggcgccggtcgccgcgccagcgccggccagcacctttaccagccaggcgcagacg
cgcccggcagcgcctgcccgtgcagcggccccgacgccggcggcctcgcagtcgccggca
cccaagcgcaaaccctacaaactggtggccatcggtacctccacgggggggccggtggcg
ctgcagcgggtactgacgcagctgccggccaatttcccggcgccgatcgtgttgatccag
cacatgccggcggccttcaccaaagcgtttgccgaacgcctggacaagctgtgccgcatc
agcgtcaaggaagccgaagacggcgacatgctgcgcccgggcctggccctgctggccccc
ggtggcaagcagatgatgatcgatggccgtggcacggtgaagatcctgcccggcgacgag
cgcctgaactacaagccgtgcgtggacatcaccttcggttcggcggccaagtcgtacggt
gacaaggtgttgtcggtggtgctcaccggcatgggcgccgatggccgcgagggcgcgcgc
ctgctcaagcaggggggcagcacggtgtgggcccaggatgaagccagctgcgtgatttat
ggcatgcccatggccatcgtcaaggcgaacctggcggatgccgtgtacagcctcgacgaa
atcggcaagcacctggtggaggcgtgcgtctga

DBGET integrated database retrieval system