KEGG   Pseudomonas putida KT2440: PP_4632Help
Entry
PP_4632           CDS       T00114                                 

Definition
short chain dehydrogenase
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
ppu  Pseudomonas putida KT2440
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ppu00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ppu00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
5255469..5256206
Genome map
AA seq 245 aa AA seqDB search
MLGGNQRTDKLTTPNMNSPILVTGASQRVGLALALELAQAGHTVVSASRSIQPQAAHPNI
VQFQADLCQAGDRQALIDHLHDRYDGLRAIIHNASLWLDDGLDNLETMFRLHVEAPYHLN
LALGDLLAKVEKADIIHICDETSSRGSKSHIGYAATKAALQNMVLSFAEKYAPKVRVNGI
LPGLLILKEGGDDAYRQQTLKKALLEFEPGAGPLIETVKYLLASQYSTGSQVVINGGRHL
KNRMT
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgctgggtggcaaccaaaggacagacaagttgaccaccccgaacatgaacagccccatt
ctcgttaccggagccagccagcgcgtcgggctggccctggccctcgaactggcacaggcc
ggccatacggtggtcagtgccagccgcagcatccagccgcaggcagcccaccccaacatc
gtgcagtttcaggccgacctgtgccaggcgggcgaccgccaggcgctgatcgatcacctg
cacgatcgttatgacggactacgcgccatcatccacaacgcctcgctatggctcgacgac
ggcctcgacaacctcgagaccatgttccgcctgcacgtcgaagcgccctaccacctcaac
ctggccctgggcgacctgctggccaaggtggaaaaggccgacatcatccacatctgcgac
gaaacctcctcgcgcggcagtaaaagccacatcggctacgccgccaccaaggccgcgctg
cagaacatggtgctgtcattcgccgaaaaatatgcgcccaaggtgcgtgtgaacggtatc
ctgcccgggctgctgatcctcaaggaagggggtgacgacgcctaccgccagcaaaccctg
aaaaaggccttgctggagttcgaacccggcgccggcccgctgatcgagaccgtcaagtac
ctgctcgccagccagtacagcaccggcagccaggtggtcatcaacggtggccgccacctg
aagaaccgcatgacttga

DBGET integrated database retrieval system