KEGG   Pseudomonas putida KT2440: PP_4651Help
Entry
PP_4651           CDS       T00114                                 

Gene name
cioA
Definition
ubiquinol oxidase subunit I, cyanide insensitive
Orthology
K00425  
cytochrome d ubiquinol oxidase subunit I [EC:1.10.3.-]
Organism
ppu  Pseudomonas putida KT2440
Pathway
Oxidative phosphorylation
Metabolic pathways
Two-component system
Module
Cytochrome d ubiquinol oxidase
Brite
KEGG Orthology (KO) [BR:ppu00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    PP_4651 (cioA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PP_4651 (cioA)
Enzymes [BR:ppu01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.3  With oxygen as acceptor
    1.10.3.-  
     PP_4651 (cioA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(5275258..5276694)
Genome map
AA seq 478 aa AA seqDB search
MFGIEALELARMQFAFTVSFHILFPAITIGLASYLAVLEGLWLRTHNQVYRDLYHFWSKI
FAVNFGMGVVSGLVMAYQFGTNWSRFSDFAGAVTGPLLTYEVLTAFFLEAGFLGVMLFGW
NRVGRGLHFFSTVMVALGTLVSTFWILASNSWMQTPQGHEIIDGRVVPVDWFAVVFNPSF
PYRLMHMATAAFVSTAFFVGASAAWHLLRGRDNPAVRKMLSMAMWMALIVAPIQAVIGDF
HGLNTLKHQPVKIAAIEGHWENVPGEPTPLILFGIPDMEAETTRFKIEIPALGSLILTHS
LDKQVPAMKEFPPEDRPNSTIVFWSFRIMVGLGFLMIFVGLWSLWLRKRGTLYSSRPFLH
VALWMGPSGLVALLAGWFTTEIGRQPWVVYGLMRTADGVSNHSYAQLGFTLVAFVVVYFA
LFGTGLGYMMRLVRKGPQTGEGDEHTPGGPGQKRTPARPLSAADDGREATSASLNEGN
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgttcggaatagaggccttagagctcgcccgaatgcagtttgcctttaccgtgtcgttc
cacatcctgttcccggccatcaccattggcctggccagctacctggcagtcctcgaaggc
ctatggctgcggacccacaaccaggtctaccgtgacctctatcacttctggtcaaagatc
ttcgccgtcaacttcggcatgggcgtcgtctccggcctggtcatggcctaccagttcggc
accaactggagccgcttctccgactttgccggcgccgtcaccggcccgctgctcacctac
gaagtactgactgcgttcttcctcgaggccggtttcctgggcgtcatgttgtttggctgg
aaccgcgtcggccgtggtctgcacttcttctccacggtgatggtagcgctcggtacgctg
gtctctaccttctggattctcgcctccaacagctggatgcaaaccccgcaaggtcacgag
atcatcgatggtcgggtggtgccggtggactggtttgcggtggtgttcaacccctccttc
ccctaccgcctgatgcacatggctactgccgcgttcgtgtccaccgcgttcttcgtcggt
gcctcggcggcctggcacctgctgcgcgggcgtgacaacccggctgtacgcaagatgctg
tcgatggccatgtggatggcattgatcgtcgccccgattcaggcagtgatcggcgatttc
cacggcctcaataccctcaagcaccagccggtgaaaattgctgcgatcgaaggccactgg
gagaacgtgcccggtgagccgactccactgatcctgttcggcattcccgacatggaggcc
gagactacccggttcaagatcgagattccggccctcggcagcctgatcctgactcacagc
ctggacaagcaggtgccggcgatgaaggagttcccgcccgaggaccggcctaattcgacc
attgtgttctggtcgttccggatcatggtcgggcttggtttcctgatgatcttcgttggc
ctgtggagcctgtggttgcgcaaacgcggcacgctgtacagttcacgcccgttcctgcat
gtggccctgtggatgggcccatctgggctggtcgcactgctggccggctggttcaccacc
gaaattggccgccagccctgggtggtgtacggcctgatgcgcacggcggacggtgtttcc
aaccacagctacgctcagctcggcttcacccttgtggcgttcgtggtggtgtacttcgcc
ctgtttggcaccggccttggctacatgatgcgcctggtgcgcaaagggccgcaaaccggt
gagggtgacgagcacacaccgggaggcccaggccagaaacgcacgccggcacggcctttg
tccgccgccgatgatggccgcgaggccacctctgccagcctgaacgaggggaactga

DBGET integrated database retrieval system