KEGG   Pseudomonas putida KT2440: PP_4651Help
Entry
PP_4651           CDS       T00114                                 

Gene name
cioA
Definition
ubiquinol oxidase subunit I, cyanide insensitive
Orthology
K00425  
cytochrome d ubiquinol oxidase subunit I [EC:1.10.3.-]
Organism
ppu  Pseudomonas putida KT2440
Pathway
Oxidative phosphorylation
Metabolic pathways
Two-component system
Module
Cytochrome d ubiquinol oxidase
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:ppu00190]
Environmental Information Processing; Signal transduction; Two-component system [PATH:ppu02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(5275258..5276694)
Genome map
AA seq 478 aa AA seqDB search
MFGIEALELARMQFAFTVSFHILFPAITIGLASYLAVLEGLWLRTHNQVYRDLYHFWSKI
FAVNFGMGVVSGLVMAYQFGTNWSRFSDFAGAVTGPLLTYEVLTAFFLEAGFLGVMLFGW
NRVGRGLHFFSTVMVALGTLVSTFWILASNSWMQTPQGHEIIDGRVVPVDWFAVVFNPSF
PYRLMHMATAAFVSTAFFVGASAAWHLLRGRDNPAVRKMLSMAMWMALIVAPIQAVIGDF
HGLNTLKHQPVKIAAIEGHWENVPGEPTPLILFGIPDMEAETTRFKIEIPALGSLILTHS
LDKQVPAMKEFPPEDRPNSTIVFWSFRIMVGLGFLMIFVGLWSLWLRKRGTLYSSRPFLH
VALWMGPSGLVALLAGWFTTEIGRQPWVVYGLMRTADGVSNHSYAQLGFTLVAFVVVYFA
LFGTGLGYMMRLVRKGPQTGEGDEHTPGGPGQKRTPARPLSAADDGREATSASLNEGN
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgttcggaatagaggccttagagctcgcccgaatgcagtttgcctttaccgtgtcgttc
cacatcctgttcccggccatcaccattggcctggccagctacctggcagtcctcgaaggc
ctatggctgcggacccacaaccaggtctaccgtgacctctatcacttctggtcaaagatc
ttcgccgtcaacttcggcatgggcgtcgtctccggcctggtcatggcctaccagttcggc
accaactggagccgcttctccgactttgccggcgccgtcaccggcccgctgctcacctac
gaagtactgactgcgttcttcctcgaggccggtttcctgggcgtcatgttgtttggctgg
aaccgcgtcggccgtggtctgcacttcttctccacggtgatggtagcgctcggtacgctg
gtctctaccttctggattctcgcctccaacagctggatgcaaaccccgcaaggtcacgag
atcatcgatggtcgggtggtgccggtggactggtttgcggtggtgttcaacccctccttc
ccctaccgcctgatgcacatggctactgccgcgttcgtgtccaccgcgttcttcgtcggt
gcctcggcggcctggcacctgctgcgcgggcgtgacaacccggctgtacgcaagatgctg
tcgatggccatgtggatggcattgatcgtcgccccgattcaggcagtgatcggcgatttc
cacggcctcaataccctcaagcaccagccggtgaaaattgctgcgatcgaaggccactgg
gagaacgtgcccggtgagccgactccactgatcctgttcggcattcccgacatggaggcc
gagactacccggttcaagatcgagattccggccctcggcagcctgatcctgactcacagc
ctggacaagcaggtgccggcgatgaaggagttcccgcccgaggaccggcctaattcgacc
attgtgttctggtcgttccggatcatggtcgggcttggtttcctgatgatcttcgttggc
ctgtggagcctgtggttgcgcaaacgcggcacgctgtacagttcacgcccgttcctgcat
gtggccctgtggatgggcccatctgggctggtcgcactgctggccggctggttcaccacc
gaaattggccgccagccctgggtggtgtacggcctgatgcgcacggcggacggtgtttcc
aaccacagctacgctcagctcggcttcacccttgtggcgttcgtggtggtgtacttcgcc
ctgtttggcaccggccttggctacatgatgcgcctggtgcgcaaagggccgcaaaccggt
gagggtgacgagcacacaccgggaggcccaggccagaaacgcacgccggcacggcctttg
tccgccgccgatgatggccgcgaggccacctctgccagcctgaacgaggggaactga

DBGET integrated database retrieval system