KEGG   Pseudomonas putida KT2440: PP_4672Help
Entry
PP_4672           CDS       T00114                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ppu  Pseudomonas putida KT2440
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PP_4672 (recD)
Enzymes [BR:ppu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     PP_4672 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(5298024..5300099)
Genome map
AA seq 691 aa AA seqDB search
MSRSLVDLLPTPLHAEHLLALAPQHNSADLLQLLDRWVERGWLRALDRAFVSFLEERAPG
SDPLLLLAAALASHQLGHGHVCLDLQQTLAEPDFALSLPPEGDALIGPLLLPSQLLANLD
LNAWLQRISASPLVAAGDTPGQQARPLVRSGERLYLRRYWSYERRIDQALRQRLSQAEAP
PADLPERLAQLFEGGAPAGQVDWQKLACALATRAGFSIITGGPGTGKTTTVVRLLALLQA
PAVEQGRPLRIRLAAPTGKAAARLTESIGQQVERLQVSAEVRGQIPTEVSTVHRLLGSRP
GSRHFRHHAGNPLPLDVLVVDEASMIDLEMMANLLDALPPRARLVLLGDKDQLASVEAGA
VLGDLCRDAEEGFYSPATAAWLQQVSGESLAGSGLKAGDEQRHPLAQQVVMLRFSRRFGE
GSGIGQLARLVNRQDAHAARNLLAAPPADVHSLSLKHEQDRAFDRLLLDGLNRGTDGPQG
YRSYLRTLGRYRPALDTAFDDPAWEQWAGKVLRSFEDFQLLCAVRRGAWGVEGLNERVAR
VLHNAGLIDSQQPWYEGRPVLVTRNDYGLGLMNGDIGIALRLPDEHGQPLLRVAFPRNDG
SGGVRFVLPSRLNEVETVFAMTVHKSQGSEFSHTALVLPEALNPVLTKELVYTGITRAKH
CFSLVEPRQGIFEEAVARKVRRISGLMLEQV
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgagccgaagccttgtcgacctgttgcccaccccgttgcacgcagagcacctgctggcg
ctggcaccgcagcacaacagcgctgacctgctgcaattactcgaccgttgggttgagcgg
ggctggctacgtgccctggaccgcgcattcgtgtcgttcctggaagagcgcgcccccggc
agtgatcccttgctattgctggcggcagcgctggccagccaccaactggggcacggacat
gtctgcctcgacctgcaacaaaccttggccgagcctgatttcgccctgtcgttgccgccg
gaaggtgacgcccttatcggccctttgctactgccatcgcaactgctggccaaccttgac
ttaaatgcctggcttcagcgcatcagcgccagcccgctggtggccgcaggtgatacgcct
ggccagcaagcgcggccgcttgtacgcagtggcgagcgcctttacctgcgccgttactgg
agttacgagcggcgcatcgaccaggccctgcgccagcgcctgagtcaggccgaagcaccg
cctgcggacctgccagagcgtctggcgcaactgttcgagggcggcgcgccagctggccag
gtggactggcagaagctcgcctgtgccttggccacccgtgccggtttcagcatcatcact
ggcggccccggtactggcaagacgaccaccgtggtgcgcctgctggcgttgctgcaggcg
ccggcagtggagcagggcaggccactgcgcatccgcctggctgcaccgaccggcaaagcc
gctgcgcgcctgaccgaatccattggtcagcaagtcgagcgcctgcaagtcagcgccgaa
gtacgtgggcaaatccccactgaagtcagcaccgtgcatcgcctgctcggcagccgcccg
ggctcgcggcactttcgccatcatgctggcaacccgttgccgttggatgtgctggtggtc
gacgaagcgtcgatgatcgacctggaaatgatggccaacctgctcgatgccttgccgccg
cgggcgcgtctggtgctgctgggcgacaaggaccagttggcctcggtcgaggccggcgcg
gtgctgggtgacctgtgccgggatgctgaggagggcttttactcgccggcgactgcagcg
tggcttcagcaggtcagtggcgagtcgctggccggcagtggccttaaggccggcgatgag
cagcgtcacccgctggcccagcaggtggtgatgctgcgtttttcacggcgtttcggtgaa
ggcagcggtattggccagctggccagactggtcaatcgtcaggacgctcacgcggcgcgc
aacctgctggccgcgccgcctgccgacgtgcacagcctttcgctcaagcacgaacaggat
cgtgcgttcgaccgcctgttactcgacggcctgaaccgcggtaccgatggaccgcaaggc
taccgcagctacctgcgcacccttggccgttaccggccggcacttgataccgcctttgac
gaccccgcctgggagcaatgggcgggcaaggtgttgcgcagttttgaggatttccagttg
ctgtgcgcggtgcgccggggcgcctggggtgtcgaaggcctcaacgagcgggtggcgcga
gtgctgcacaatgccggtctgatcgacagccagcagccctggtacgaagggcgcccggtg
ctggtgacccgcaacgactacggccttggcctgatgaacggtgacatcggtattgccctg
cgcctgccggatgagcatggccagccgctgctgcgcgtggccttcccgcgcaacgacggc
agtggtggtgtgcgattcgttctgccgagccggctcaacgaagtggagacggtattcgcc
atgaccgtgcacaagtcccagggctcggagttcagccacactgccctggtgctgccggag
gcgctcaacccggtgctgaccaaggaactggtgtacaccggcatcacccgggccaagcac
tgcttcagcctggtcgagccacgccaaggcattttcgaagaagcggtggcgcgcaaagta
cggcgtatttccgggttgatgctcgagcaggtctag

DBGET integrated database retrieval system